KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1960
Entry
SPUL_1960         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K07127  5-hydroxyisourate hydrolase [EC:3.5.2.17]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00230  Purine metabolism
sel01100  Metabolic pathways
sel01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPUL_1960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sel02000]
    SPUL_1960
Enzymes [BR:sel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.17  hydroxyisourate hydrolase
     SPUL_1960
Transporters [BR:sel02000]
 Other transporters
  Others
   SPUL_1960
SSDB
Motif
Pfam: Transthyretin bMG3 CarboxypepD_reg Big_1 MG4 DUF4198 CarbopepD_reg_2
Other DBs
NCBI-ProteinID: AET54288
Structure
PDB: 
2GPZ

Position
complement(1953075..1953485)
AA seq 136 aa
MKRHILATVIASLVAAPAMALAAGNNILSVHILDQQTGKPAPGVEVVLEQKKDNGWTQLN
TGHTDQDGRIKALWPEKAAAPGDYRVIFKTGQYFESKKLDTFFPEIPVEFHISKTNEHYH
VPLLLSQYGYSTYRGS
NT seq 411 nt   +upstreamnt  +downstreamnt
atgaaacgacatatactggctaccgtgatagcatctcttgttgcagccccggcaatggcg
ctggccgctggcaacaatattctcagcgtacatattctcgatcagcaaacaggcaaaccg
gcgcccggcgtggaggtggtactggagcagaaaaaggataacggatggacgcaattaaac
accgggcataccgaccaggatggacgtattaaagcactgtggcccgaaaaagctgccgcg
ccgggggattatcgcgttatttttaaaaccggccagtattttgaaagtaaaaaactggat
acgtttttcccggagattcccgtcgagtttcatatcagcaaaacgaatgagcactatcat
gtgccgctgttattaagtcagtatggttattcaacctatcgcgggagctaa

DBGET integrated database retrieval system