KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1961
Entry
SPUL_1961         CDS       T01740                                 

Gene name
copR
Definition
(GenBank) response regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sel02022]
    SPUL_1961 (copR)
Two-component system [BR:sel02022]
 OmpR family
  Unclassified
   SPUL_1961 (copR)
SSDB
Motif
Pfam: Response_reg Trans_reg_C
Other DBs
NCBI-ProteinID: AET54289
Position
1953621..1954301
AA seq 226 aa
MKILLIEDNQKTIEWVRQGLTEAGYVVDYACDGRDGLHLALQEHYSLIILDIMLPGLDGW
QVLRALRTAHQSPVICLTARGSVEDRVKGLEAGANDYLVKPFSFAELLARVRAQLRQHVP
VFTRLTINGLDMDATKQSVSRNGKPISLTRKEFLLLWLLASRAGEIVPRTAIASEVWGIN
FDSETNTVDVAIRRLRAKVDDPFEKKLIMTVRGMGYRLQAETSQNG
NT seq 681 nt   +upstreamnt  +downstreamnt
atgaagattttattgattgaagataaccagaaaaccattgagtgggtacgtcagggactc
acggaagcaggctatgtggttgattatgcctgtgatggacgagacggattacacctggcc
cttcaggaacattattcattgattattcttgatattatgctgccggggcttgatggatgg
caggttttacgcgcgttacgcactgcgcatcagtcccctgttatttgcctgacggcgcgc
ggctcggttgaggatcgcgtcaaaggtcttgaggcgggcgctaatgattaccttgttaag
cctttttccttcgccgaactgctggcccgggtgagagctcaactcagacagcatgtccct
gtctttacccgactgacgatcaatggtctggacatggatgccacaaagcaatcggtgtca
cgaaatggcaaaccgatttccctgacccgcaaagaattcctgctcctctggttactggcg
tcccgggcaggagaaatcgtgccccgaaccgcgatcgccagcgaagtttggggaattaac
tttgatagtgaaaccaacaccgttgatgtcgcgattcgtcggctgcgcgccaaagtagac
gatccatttgaaaagaagctcattatgaccgtccgggggatgggttatcgattacaggcg
gaaacgtcgcagaatggttaa

DBGET integrated database retrieval system