KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1962
Entry
SPUL_1962         CDS       T01740                                 

Gene name
copS
Definition
(GenBank) histidine kinase
  KO
K02484  two-component system, OmpR family, sensor kinase [EC:2.7.13.3]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sel01001]
    SPUL_1962 (copS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sel02022]
    SPUL_1962 (copS)
Enzymes [BR:sel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SPUL_1962 (copS)
Protein kinases [BR:sel01001]
 Histidine kinases
  OmpR family
   SPUL_1962 (copS)
Two-component system [BR:sel02022]
 OmpR family
  Unclassified
   SPUL_1962 (copS)
SSDB
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_5 HATPase_c_2
Other DBs
NCBI-ProteinID: AET54290
Position
1954309..1955658
AA seq 449 aa
MTLRLTISFIAILILACTGISWTLYNALSKELTYRDDMTLINRAAQMQQLLLDGARPENL
PLYFNRMVDTKQDILLIHSATGHNVAINHSGIPDQRFNEIPLAKNITRETLFRQAVQGTE
LTAVRVNARSGDDPLTLTIARLATERRQMLTQYRRNSLLMSLIAILVCSALSPLVIRNGL
RAITSLSRLTAATDSGTLNQPLAEQALPVELRPLGQALNTMRQKLSDDFERLNQFADDLA
HELRTPVNILLGKNQVMLSQERSAEEYQQALVDNIEELEGLSRLTENILFLARAEHQNIA
VKKQPVSLNALVENMLDYLSPLAEEKRICFINQCQGTVWADEILLQRVLSNLLTNAIRYS
DENAVIRIESAYDDNVAEIRVANPGSHPADADKLFRRFWRGDNARHTAGFGLGLSLVNAI
ALLHGGSASYRYADEHNIFSVRLPDSGDS
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgacgctgcgcctgacaatttcttttatcgccatccttatcctcgcctgtaccggcatt
agctggacgctctataacgcgctgagcaaagaattaacgtatcgtgatgatatgacgcta
ataaatcgggcggcgcaaatgcagcaactgttactggatggcgccaggccggaaaatctg
ccgctctatttcaatcggatggtggatacgaagcaggatatcttattgatccattcagca
acaggccacaatgttgcgattaatcatagcggcatccccgaccaacgctttaacgagatt
ccgctggctaaaaacatcacccgcgaaaccttatttcgccaggcggtacaaggcacggaa
cttaccgcggtacgagtaaacgccagaagcggcgatgacccgctgacccttactattgcc
aggctggcgacggaaaggcggcaaatgctgacgcaatatcgccgcaacagtttgctgatg
agccttatcgcgatcctcgtctgttcggcgctcagtccattagtcatcagaaacgggctg
cgggccattacgtcgctcagccgactcaccgcggcgacagatagcggcacactaaaccag
ccgttggcggaacaggcgttacccgttgagctcaggccgcttggacaagcgctaaatacc
atgcgccagaagctttccgacgattttgaacgcctgaaccaatttgccgacgatctggcg
catgagctgcgcacgccggttaatattttactggggaagaatcaggtgatgctgagtcag
gaacgcagcgccgaagagtatcaacaagcccttgtcgataatattgaagagctggaggga
ctgtcgcgactgacagaaaatattctctttctggcacgcgcggagcaccagaatatagcg
gtaaaaaaacagcctgtttcgctcaatgcgctggtcgaaaatatgctggattatcttagc
ccccttgccgaggagaagcgcatctgttttataaatcaatgtcagggaacggtatgggct
gacgaaatattattacaaagagtgctctcaaacctgctgacgaatgccatccgttattct
gatgaaaacgccgtgatacgtattgaaagcgcttatgatgataacgttgcagaaattcgg
gtcgctaatccgggcagccacccagccgatgcggataagcttttccggcgtttttggcga
ggagataatgcccgccacactgccggtttcggcctggggttatcgttagttaacgcgatt
gctctattacacggtggttcggcatcttaccgctatgccgatgaacataatatcttttcg
gttcgtctgcccgatagcggtgatagctaa

DBGET integrated database retrieval system