KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1963
Entry
SPUL_1963         CDS       T01740                                 

Gene name
pipD
Definition
(GenBank) putative secreted peptidase
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: Peptidase_C69
Other DBs
NCBI-ProteinID: AET54291
Position
1955738..1957300
AA seq 520 aa
MPAKNIAGSITFSVSNPGSIHPITRYSVGTFMKKYLAFAVTLLGMGKVIACTTLLVGNQA
SADGSFIIARNEDGSANNAKHKVIHPVAFHQQGEYKAHRNNFSWPLPETAMRYTAIHDFD
TNDNAMGEAGFNSAGVGMSATETIYNGRAALAADPYVTKTGITEDAIESVILPVAQSARQ
GAKLLGDIIEQKGAGEGFGVAFIDSKEIWYLETGSGHQWLAVRLPADSYFVSANQGRLRH
YDPNDNANYMASPTLVSFAKKQGLYDPARGEFDFHQAYSQDNKNDTTYNYPRVWTLQHQF
NPHLDTAVSEVETFPVFLTPITKISVAAVKNALRNNYQGTSHDPYASHNPQEPWRPISVF
RTQESHILQVRPKLPQAIGNVEYIAYGMPSLSVYLPYYQGMRHYQPGDDKGTDRASNDST
YWTFRTLQTLVMQDYNAFAPDVQHAWKTFEQQTAKQQYKMEQSYLRLYASHPKEAQRLLQ
NFEDKTMQNAQTLAHRLTNNIITTMTYRTDMKYHFSSTQP
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgccggcaaagaatattgctggctcgatcactttctcggtttccaatccagggtcaatt
catcccataacgcgttattcagtgggaacctttatgaaaaagtatcttgcattcgccgtt
acgctgctgggtatgggtaaagtcatcgcctgtactacccttttggtaggcaatcaggct
tcggctgacggctccttcattatcgcgcgcaacgaagatggctcggcaaataacgccaag
cataaggttattcatcccgtcgcgtttcatcaacaaggcgagtataaagcacatcgcaac
aattttagctggccgcttccggagacagcgatgcgctatacggcgattcatgactttgat
actaacgataacgccatgggtgaagccggtttcaattcggcgggcgtcggaatgagcgca
acggaaaccatttataacggcagagcggcgctggctgccgatccttacgtgacaaaaaca
ggaatcacggaagacgccattgagtccgtgatcctgccagtggcgcaatcggcgcgtcag
ggcgccaaattactgggagacattattgaacaaaaaggcgctggcgaaggtttcggcgtc
gcgtttattgatagcaaagagatatggtatctggagacgggaagcggtcatcaatggctg
gcagtacgacttccggcagatagctatttcgtttccgccaatcagggacgtttacgccat
tacgatccgaatgataacgcgaattatatggcgtcaccaacgttagtaagctttgcgaaa
aagcagggattatatgatccggcccgcggcgaattcgactttcatcaagcctattcgcag
gataacaaaaacgataccacctataattatccgcgcgtctggacgctacaacaccagttt
aatccgcatctggatacggccgttagcgaagtggaaacatttcctgtttttttaacgcca
ataacaaaaattagcgtggcggcagtaaaaaacgcgttacgaaataactatcagggaacg
tcgcacgacccttatgccagtcataatccacaagaaccatggcgacccatatccgttttt
cgtacccaggagtcgcatattttacaggtcagaccgaaattaccgcaggctatcggcaac
gtagaatacatcgcctatggaatgccatctcttagcgtctatctcccctattatcagggg
atgcgtcattatcaacccggagatgataaaggaaccgatcgggcgagcaacgactctacc
tactggacattccgcacgctgcaaacgctggttatgcaggactacaatgcgtttgcgcca
gatgtgcaacacgcctggaaaacatttgaacagcaaacagctaagcagcagtataagatg
gagcagagctatctgagattatatgcgtcgcatccgaaagaagcgcaacgcttactgcaa
aattttgaagataaaacgatgcaaaatgcgcagacgctcgcccatcgcctgaccaataat
attattacgacaatgacttaccgtacagatatgaaatatcacttttcaagtacgcaacca
taa

DBGET integrated database retrieval system