KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1964
Entry
SPUL_1964         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Other DBs
NCBI-ProteinID: AET54292
Position
complement(1957303..1957488)
AA seq 61 aa
MKRTTCLYTSWVFAAFVSLLIFAWSVINYPLYESIIIIVFYIWLILVPLYLIVYEWLIDC
H
NT seq 186 nt   +upstreamnt  +downstreamnt
ttgaaaagaacaacgtgcttatatacctcctgggtttttgccgcttttgtctctctgctg
atatttgcctggagtgtcataaactatcctctctatgaatccataataattattgtcttt
tatatctggctaattctggtaccgctttatcttattgtgtatgagtggctaatagattgt
cattaa

DBGET integrated database retrieval system