KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1965
Entry
SPUL_1965         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: DUF3950 PurS
Other DBs
NCBI-ProteinID: AET54293
Position
complement(1957520..1957660)
AA seq 46 aa
MTKNIRFSYSMLEQIEFALKSEKTRNFSAWVKEACREKLCNTGHKL
NT seq 141 nt   +upstreamnt  +downstreamnt
gtgacgaagaatattcgtttttcctattccatgcttgaacagatagaattcgcgttgaaa
tctgaaaagacgcggaatttttcagcatgggtaaaagaggcctgtcgggaaaagttatgt
aacacgggacataagctgtag

DBGET integrated database retrieval system