KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1967
Entry
SPUL_1967         CDS       T01740                                 

Gene name
pipC
Definition
(GenBank) cell invasion protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: Chaperone_III
Other DBs
NCBI-ProteinID: AET54295
Structure
PDB: 
1K3S

Position
1959724..1960065
AA seq 113 aa
MESLLNRLYDALGLDAPEDEPLLIIDDGIQVYFNESDHTLEMCCPFMPLPDDILTLQHFL
RLNYTSAVTIGADADNTALVALYRLPQTSTEEEALTGFELFISNVKQLKEHYA
NT seq 342 nt   +upstreamnt  +downstreamnt
atggaaagtctattaaatcgtttatatgacgcgttaggcctggatgcgccagaagatgag
ccactgcttatcattgatgatgggatacaggtttattttaatgaatccgatcatacactg
gaaatgtgctgtccctttatgccattgcctgacgacatcctgactttgcagcatttttta
cgtctgaactacaccagcgccgtcactatcggcgctgacgcagacaatactgctttagtg
gcgctttatcgcttgccacaaaccagtaccgaagaagaggcgctcactggttttgaatta
ttcatttcaaacgtgaagcaattgaaagagcattatgcataa

DBGET integrated database retrieval system