KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1968
Entry
SPUL_1968         CDS       T01740                                 

Gene name
pipB
Definition
(GenBank) pathogenicity island protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: Pentapeptide Pentapeptide_4
Other DBs
NCBI-ProteinID: AET54296
Position
1960613..1961488
AA seq 291 aa
MPITNASPENILRYLHAAGTGTKEAMKSATSPRGILEWFVNFFTCGGVRRSNERCFQEVI
GKLTTSLLYVNKDAFFDGNKIFLEDVNGCTICLSCGAASENTAPMVIIEVNKNGKTVTDK
VDSERFWNVCRMLKLMSKHNIQQPDSLITEDGFLNLRGVNLAHKDFQGEDLSDIDASDAD
FRETTLSNVNLVGANLCCANLHAVNLMGSNMTKANLTHANLTCANMSGVNLTAAILFGSD
LTDTKLNGAKLDKIALTLAKSLTGADLTGSQHTPTPLPDYNDITLFPHPIF
NT seq 876 nt   +upstreamnt  +downstreamnt
atgccaataactaacgcgtccccagaaaatatattaagatatttgcatgcggccggtacc
ggtacgaaagaagcaatgaaaagtgcaacttcaccacgcggtatactggaatggtttgtc
aatttttttacctgtggtggagtaagaagaagcaatgaaagatgctttcaggaggtaatt
ggaaaactgaccacatcattattatatgtaaataaagatgctttcttcgatggtaataaa
atatttctggaggatgtcaacgggtgtactatatgtctgtcatgtggagcagcatccgaa
aatacggctcccatggtcattattgaagtgaacaaaaatggaaaaactgtaacggataaa
gttgatagtgagagattttggaatgtatgccgaatgttaaagctgatgagtaaacataat
atacaacagcctgattcacttataaccgaggatggttttctgaacctgcgcggagtaaat
ctggctcataaagatttccagggggaagatttgtcagacatagatgcttctgatgcagat
ttccgtgaaacaactctatctaatgtaaatttagtcggtgcaaatttgtgttgtgcaaat
ctacacgctgtaaatctaatgggttcaaacatgactaaagcaaacctgactcacgcaaac
ctgacttgcgctaacatgtccggtgtaaacttaaccgctgcaattctattcggctcagac
ttaactgacaccaaactaaatggtgcgaaattagataagatagctctaactttagcgaaa
tcattaacaggagccgatctgacaggtagtcaacatacccctactccactcccggattac
aatgatataactcttttcccccatccgatattttag

DBGET integrated database retrieval system