KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1969
Entry
SPUL_1969         CDS       T01740                                 

Gene name
pipA
Definition
(GenBank) pathogenicity island protein
  KO
K23941  PipA/GogA/GtgA family effector protease
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sel00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    SPUL_1969 (pipA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sel01002]
    SPUL_1969 (pipA)
Peptidases and inhibitors [BR:sel01002]
 Metallo peptidases
  Family M85
   SPUL_1969 (pipA)
SSDB
Motif
Pfam: PipA Peptidase_M85 DUF4765 CHASE3
Other DBs
NCBI-ProteinID: AET54297
Position
1961885..1962388
AA seq 167 aa
MVEYLISGAGGIDPDTEIDDDTYDECYDELSSVLQNAYTQSETFRRLMSYAYEKELHDVE
QRWLLGAGEAFETTVAQEHFKLSEGRKVICLNLDDSDDSYTEHYESNEGRQLFDTKRSFI
HEVVHALTHLQDKEENHPRGPVVEYTNIILKEMGHPSPPRMVYIFNK
NT seq 504 nt   +upstreamnt  +downstreamnt
gtggtggagtaccttatctcaggcgcgggtggaatagaccctgatacagaaattgatgac
gacacttatgacgaatgctacgatgaactatcctccgtacttcaaaatgcgtatacccaa
agcgaaacattccgcagactgatgagttacgcatatgaaaaagaactacatgatgtggag
cagcgctggctactgggggcaggcgaagcctttgaaactaccgtggctcaggaacacttc
aaactttcagaaggcaggaaagttatttgtctcaatctggacgattctgatgattcatat
accgaacattatgaaagtaacgaaggaagacaactttttgacacaaaacgttcatttatt
catgaagttgtacatgcactgacccatcttcaggataaagaagaaaatcatccaagaggc
cctgttgtcgaatataccaacattattctgaaagagatggggcatccttcacctcccaga
atggtctacatcttcaataaatag

DBGET integrated database retrieval system