KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1970
Entry
SPUL_1970         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K19416  modulator of FtsH protease
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sel02000]
    SPUL_1970
Transporters [BR:sel02000]
 Other transporters
  Pores ion channels [TC:1]
   SPUL_1970
SSDB
Motif
Pfam: Bax1-I DUF2583
Other DBs
NCBI-ProteinID: AET54298
Position
1963007..1963666
AA seq 219 aa
MDRIITSSRDRSSLLSTHKVLRNTYFLLSLTLAFSAITATASTVLMLPSPGLILTLVGMY
GLMFLTYKTANKPVGILSAFAFTGFLGYILGPILNAYLSAGMGDVIGLALGGTALVFFCC
SAYVLTTRKDMSFLGGMLMAGIVVVLIGMVANIFLQLPALHLAISAVFILISSGAILYET
SNIIHGGETNYIRATVSLYVSLYNIFVSLLSILGFASRD
NT seq 660 nt   +upstreamnt  +downstreamnt
atggatcgtatcattacatcatcgcgtgatcgtagctcgctactgagtacgcacaaagta
ctgcgcaacacctattttctgttgagcctgacgctggctttctccgcaattaccgcgaca
gccagtacggtactgatgctgccctcccccggcctgattctgacgctggtcggtatgtat
gggctgatgttcctgacctataaaaccgccaataagccggtcggtatcctgtctgctttt
gcgtttaccggcttcctcgggtatatcctgggcccgattcttaacgcctatctgtcagca
ggcatgggcgatgtcattggcctggcgctgggtggtaccgcgttagtatttttctgctgc
tccgcttacgttctgaccacccgtaaggatatgtctttcctgggcggtatgttaatggcc
gggatcgtcgtcgtgctgattggtatggtggcgaatattttcctgcaactgcctgcattg
cacctggcgattagcgcggtgtttatcctgatttcctcgggcgctatcctgtatgaaacc
agtaacatcattcacggcggtgaaaccaactatattcgtgcgaccgtcagtctgtacgtt
tcgctgtacaacatctttgtcagcctgctcagcattctgggcttcgccagccgcgactaa

DBGET integrated database retrieval system