KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1971
Entry
SPUL_1971         CDS       T01740                                 

Gene name
yccK
Definition
(GenBank) hypothetical protein in helD-serT intergenic region
  KO
K11179  tRNA 2-thiouridine synthesizing protein E [EC:2.8.1.-]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SPUL_1971 (yccK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sel03016]
    SPUL_1971 (yccK)
Enzymes [BR:sel01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.-  
     SPUL_1971 (yccK)
Transfer RNA biogenesis [BR:sel03016]
 Prokaryotic type
  tRNA modification factors
   Thiolation factors
    SPUL_1971 (yccK)
SSDB
Motif
Pfam: DsrC Staph_opine_DH
Other DBs
NCBI-ProteinID: AET54299
Position
1963753..1964082
AA seq 109 aa
MLIFEGKEISTDSEGYLKETTQWSETLAVAIAANEGIELSAEHWEVVRFVREFYLEFNTS
PAIRMLVKAMANKFGEEKGNSRYLYRLFPKGPAKQATKIAGLPKPVKCI
NT seq 330 nt   +upstreamnt  +downstreamnt
atgttgatctttgaaggtaaagaaatcagtactgatagcgaaggctatctgaaagagacg
acgcagtggagtgaaacgctggcagtcgctatcgccgccaatgaaggcattgagctctct
gcggaacactgggaagtcgtgcgcttcgtgcgcgaattttacctggagtttaatacctct
cccgccatccgaatgctggtaaaagcgatggcgaataagttcggcgaagaaaaaggcaac
agccgctatctgtatcgtctgttcccgaaaggcccggcaaagcaagcgaccaaaatcgcc
ggtctgcccaagccggtaaaatgtatctaa

DBGET integrated database retrieval system