KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1972
Entry
SPUL_1972         CDS       T01740                                 

Gene name
yccX
Definition
(GenBank) putative acylphosphatase
  KO
K01512  acylphosphatase [EC:3.6.1.7]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00620  Pyruvate metabolism
sel00627  Aminobenzoate degradation
sel01100  Metabolic pathways
sel01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPUL_1972 (yccX)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SPUL_1972 (yccX)
Enzymes [BR:sel01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.7  acylphosphatase
     SPUL_1972 (yccX)
SSDB
Motif
Pfam: Acylphosphatase
Other DBs
NCBI-ProteinID: AET54300
Position
complement(1964079..1964360)
AA seq 93 aa
MSNVCIIAWVYGRVQGVGFRYTTQHEAQRLGLTGYAKNMDDGSVEVVACGDAAQVEKLIK
WLKEGGPRSARVDKILTEPHSPRETLTGFSIRY
NT seq 282 nt   +upstreamnt  +downstreamnt
atgtcgaacgtctgcattatcgcctgggtttatggtcgcgttcagggcgtcgggtttcgc
tataccacgcagcatgaggcgcagcggctggggttaaccggctatgcgaagaatatggat
gacggaagcgtagaagtggtggcctgtggcgacgcggcgcaggtagaaaagctcatcaag
tggctgaaagagggcgggccgcgctctgctcgtgtggacaaaatcctcactgaaccgcac
agccctcgcgagacgttaacaggcttcagtattcggtattag

DBGET integrated database retrieval system