KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1973
Entry
SPUL_1973         CDS       T01740                                 

Definition
(GenBank) putative transcriptional regulator
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: HTH_18 HTH_AraC HTH_23 Sigma70_r4_2 AraC_N SurA_N Cupin_2 Sigma70_r4 AraC_binding HTH_11 HTH_Tnp_ISL3 HTH_38
Other DBs
NCBI-ProteinID: AET54301
Position
complement(1964409..1965197)
AA seq 262 aa
MQEMHIRHQDLTTAEVRSSHLHRLHRVTLFSAAICHITQGSKVIIQYDSRLVAGPGELII
IPANTPLEIINQPAQNGFRSDLLLLSPEIIARFKTMYVQDYPPANLTSLCTPMSRSLTFM
WENVLDAVRQGLPVGLQEHQAMGLLLALLHDGAAGPLLIERRYTLTEQVRQLIMLSPAKL
WTAQEIARRLAMGTSTLRRRLQRESQSYRQIIEEVRMSCALSQLQSTTLPIGEIALRCGY
LSGSRFTARFRQHYGCLPSQVR
NT seq 789 nt   +upstreamnt  +downstreamnt
gtgcaggagatgcatattcgacatcaggatcttacgacggcagaggtgcgttccagtcat
ctgcaccgtttgcatcgtgttacgcttttttccgccgctatctgccatattacgcagggc
agtaaagtcatcattcagtatgatagccgccttgtcgccgggccgggcgagttgattatt
attccggcgaacacgccgctggagattattaatcagcctgcgcagaacggttttcgctcc
gacctgttgttactttcaccggagattattgctcgctttaaaacgatgtacgttcaggat
tatccaccggcaaacctgacatcgctgtgtaccccgatgagccgtagcctgacatttatg
tgggagaacgtgttggatgctgtgcgccagggcttacctgtcgggctacaggaacatcag
gcgatggggttactgttagcgcttttgcatgatggcgcggcgggaccgctgcttattgaa
cggcgttacaccctcacggagcaggtgcggcaactgattatgctctcacctgctaagcta
tggacagcccaggagatagcccgccgtcttgctatgggaacatcgacgctgcgtcggcgt
ttgcagcgcgaatcgcagagttatcggcaaattattgaagaggtacgcatgtcctgcgcg
ctttctcaactgcaatcgacgacgctgccgatcggcgaaatagcgctacggtgcggctac
ctgtcggggtcgcgatttacggccagattccgccaacattatgggtgtctgcctagtcag
gtacgttaa

DBGET integrated database retrieval system