KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1975
Entry
SPUL_1975         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K06969  23S rRNA (cytosine1962-C5)-methyltransferase [EC:2.1.1.191]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sel03009]
    SPUL_1975
Enzymes [BR:sel01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.191  23S rRNA (cytosine1962-C5)-methyltransferase
     SPUL_1975
Ribosome biogenesis [BR:sel03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SPUL_1975
SSDB
Motif
Pfam: Methyltrans_SAM PUA_3 Cons_hypoth95 Methyltransf_31 MTS Methyltransf_25 Methyltransf_15 Met_10 PrmA TRM Methyltransf_11 PUA Methyltransf_10 Methyltransf_12
Other DBs
NCBI-ProteinID: AET54303
Position
1965977..1967188
AA seq 403 aa
MTESTFPQYPRLVLSKGREKSLLRRHPWVFSGAVSRLEGKANLGETIDIVDHQGKWLARG
AWSPASQIRARVWTFDKAESIDIAFFTRRLRQAQQWRDWLAKKDGLDSYRLIAGESDGLP
GVTIDRFGHFLVLQLLSAGAEYQRAALISALQTCDPDCAIYDRSDVAVRKKEGMALTQGP
VTGELPPALLPIEEHGMKLLVDIQGGHKTGYYLDQRDSRLATRRYVENQRVLNCFSYTGG
FAVSALMGGCRQVVSVDTSQDALDIARQNVELNQLDLSKAEFVRDDVFKLLRAYREHGEK
FDVIIMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGILLTFSCSGLMTSDLFQKII
ADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgactgaatctacatttccgcaatatccccgtttagtcctcagcaaagggcgagaaaaa
tctttactccgccgccacccatgggtcttttccggcgccgtatcccgtctggaaggcaaa
gccaacctcggtgaaactatcgatatcgtcgaccatcagggaaagtggttagcacgcggc
gcctggtcaccagcctcccagatccgcgcgcgcgtctggacatttgataaagcagaatcc
attgatattgcgtttttcacccgccgcctgcgccaggcgcagcagtggcgcgactggctg
gcgaaaaaagacggcctggatagctatcgtctgatcgccggtgagtccgatggcctgcct
ggcgtcactatcgatcgttttggtcattttttggtgctgcaactgctcagcgccggggcc
gaatatcaacgcgccgcattaattagtgcgctgcaaacatgcgatccggattgcgctatt
tacgatcgcagcgacgtcgccgtgcggaaaaaagaagggatggcgctgacgcaaggtccg
gtcactggcgaactgccgcctgcgcttttgccaattgaagaacacggtatgaaattgctg
gtcgatatccagggcggccacaaaaccggttattatcttgatcagcgcgacagtcgtctg
gcgacgcgccgctacgtggaaaatcagcgggtactgaactgcttctcttataccggcggt
tttgccgtgtcggcgttaatgggcggttgtcgccaggttgtcagcgtggatacctcacag
gatgcgctggatatcgccaggcaaaacgttgaactgaaccaactggacttgagcaaagcc
gaattcgtgcgcgacgacgtgtttaagttgctgcgcgcttaccgtgaacacggcgaaaaa
ttcgacgtcatcatcatggacccgcccaaattcgttgaaaataaaagccagttaatgggc
gcctgccggggctataaagacattaacatgttagcgattcaactgctcaatccgggcggc
atactgctgacattctcttgctccggactgatgaccagcgatttatttcagaaaatcatt
gccgatgccgcaatagatgccggtcgtgatgtacaatttatagagcagttccgtcaggcc
gccgatcacccggtgatcgccacctacccggaagggctgtatctgaaagggtttgcctgt
cgcgtcatgtaa

DBGET integrated database retrieval system