KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1976
Entry
SPUL_1976         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K11940  heat shock protein HspQ
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sel03036]
    SPUL_1976
Chromosome and associated proteins [BR:sel03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    SPUL_1976
SSDB
Motif
Pfam: YccV-like
Other DBs
NCBI-ProteinID: AET54304
Position
1967247..1967564
AA seq 105 aa
MIASKFGIGQQVRHSLLGYLGVVVDIDPEYSLDEPSPDELAVNDELRAAPWYHVVMEDDD
GQPVHTYLAEAQLRSEMRDEHPEQPSMDELARTIRKQLQAPRLRN
NT seq 318 nt   +upstreamnt  +downstreamnt
atgatagccagcaaattcggtatcggccaacaggtccgccattccctgttaggttacctc
ggagtggtcgtcgatatcgacccggaatattcgcttgatgagccgtcgcctgatgagctg
gcggttaacgacgaacttcgcgccgctccgtggtaccacgtggtaatggaagatgatgat
ggtcagccagtgcatacttatctggccgaggcccagttgcgaagcgaaatgcgggacgag
catccagaacagccatcgatggatgaactggcgcgtaccattcgcaagcagcttcaggcg
ccgcgactacgtaactga

DBGET integrated database retrieval system