KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1977
Entry
SPUL_1977         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K06929  uncharacterized protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SPUL_1977
SSDB
Motif
Pfam: CoA_binding_2 CoA_binding
Other DBs
NCBI-ProteinID: AET54305
Position
complement(1967609..1968025)
AA seq 138 aa
MMKETDIADVLTSTRTIALVGASDKPDRPSYRVMKYLLEQGYHVIPVAPKVAGKALLGQQ
GYDTLADIPEKVDMVDVFRNSEAAWGVAQEAIAIGAKTLWLQLGVINEQAAVLARDAGMT
VVMDRCPAIEIPRLGLAK
NT seq 417 nt   +upstreamnt  +downstreamnt
atgatgaaagagaccgatattgctgatgttttgacgtccactcgcactatcgcgctggta
ggtgcgagcgataaacccgatcgtccaagttatcgggtaatgaaatacctgcttgaacag
ggctaccatgtgattccggttgcgccaaaagtcgcgggtaaggcattgctggggcaacag
gggtatgacacgctggcggacattcccgaaaaagtcgatatggtggatgtttttcgcaac
tctgaagctgcatggggcgtcgcgcaggaagctatcgccatcggcgcaaaaacgctatgg
ctacagcttggcgtgatcaacgaacaggcggcggtgctggcgcgggatgcaggcatgacc
gtggtgatggatcgctgcccggcgattgagatccctcgcctggggctggcgaaataa

DBGET integrated database retrieval system