KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1978
Entry
SPUL_1978         CDS       T01740                                 

Gene name
yccT
Definition
(GenBank) putative secreted protein
  KO
K09909  uncharacterized protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SPUL_1978 (yccT)
SSDB
Motif
Pfam: DUF2057
Other DBs
NCBI-ProteinID: AET54306
Position
1968196..1968858
AA seq 220 aa
MKTGALATFLALCLPVTVFATTLRLSNEVDLLVLDGKKVSSSLLRGAESIELENGPHQLV
FRVEKTIRLPGNEERLYISPPLVISFDTQLISQVNFQLPRLENEREASHFNAAPRLALLD
GDAMPIPVKLDILAITSTAKVVDYEIETERYNKSAKRASLPQFATMMADDSTLLSDVSEL
DTVPPQSQTLTEQRLKYWFRLADPQTRHHFLQWAEKQPPS
NT seq 663 nt   +upstreamnt  +downstreamnt
atgaaaaccggcgcgctagccaccttccttgctctctgtttgccggtgactgtttttgcc
acaacgctccgtttgtctaatgaggttgatctgctggtgctggacggcaaaaaggtgtcc
agctctttattacgcggcgcagagagcattgaactggaaaacgggccgcatcaactcgtt
ttccgggtggaaaaaaccatccgcctgcccggtaatgaagagcggctttatatttctccg
ccgctggtgataagtttcgatacccaactgataagtcaggtcaatttccagctcccgcgg
ctggaaaacgagcgcgaagcctcgcattttaacgcggcgccgcgtctggcgcttttggac
ggcgacgccatgcccattccggtaaaactcgatattctggccattacttctacggctaaa
gtggtcgattatgaaatagagaccgagcgttataataaatcggcgaaacgcgcctcgctt
cctcagttcgccacgatgatggcagacgacagcacattactttccgacgtctcagagctt
gataccgtaccgccgcaatcacaaactctgacagaacagcggctgaaatattggttccga
ctggccgacccgcagacacgccatcattttctgcaatgggcggaaaaacagccgccctct
tga

DBGET integrated database retrieval system