KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1979
Entry
SPUL_1979         CDS       T01740                                 

Gene name
mgsA
Definition
(GenBank) methylglyoxal synthase
  KO
K01734  methylglyoxal synthase [EC:4.2.3.3]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00640  Propanoate metabolism
sel01100  Metabolic pathways
sel01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SPUL_1979 (mgsA)
Enzymes [BR:sel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.3  methylglyoxal synthase
     SPUL_1979 (mgsA)
SSDB
Motif
Pfam: MGS Phage_TTP_13
Other DBs
NCBI-ProteinID: AET54307
Position
1968953..1969396
AA seq 147 aa
MELTTRTLPTRKHIALVAHDHCKQMLMNWVERHQPLLEKHVLYATGTTGNLIQRATGMDV
NAMLSGPMGGDQQVGALISEGKIDVLIFFWDPLNAVPHDPDVKALLRLATVWNIPVATNV
STADFIIQSPHFNDAVDILIPDYAPSA
NT seq 444 nt   +upstreamnt  +downstreamnt
atggaactgacgactcgcaccttgccgacgcgcaaacatatcgcgttggttgctcacgac
cactgcaaacagatgttaatgaactgggtggaacgccatcagccgttgctggaaaaacac
gttctttatgcaaccggcaccacggggaatctgatccagcgcgcaaccggtatggacgtt
aatgcgatgctgagcggcccgatgggcggcgaccagcaggttggcgcactcatttcagaa
gggaaaatcgacgtgttgattttcttctgggacccgcttaacgcggtaccgcacgacccc
gatgtcaaagcgctactgcgtctggccaccgtatggaatatccctgtcgccactaacgtc
tcaacggcggactttatcatccagtccccgcattttaatgacgctgtagatattcttatt
ccggattatgcgccgagcgcctga

DBGET integrated database retrieval system