KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1980
Entry
SPUL_1980         CDS       T01740                                 

Gene name
helD
Definition
(GenBank) helicase IV (75 kD helicase)
  KO
K03658  DNA helicase IV [EC:3.6.4.12]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sel03400]
    SPUL_1980 (helD)
Enzymes [BR:sel01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SPUL_1980 (helD)
DNA repair and recombination proteins [BR:sel03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   DNA helicases
    SPUL_1980 (helD)
SSDB
Motif
Pfam: Helicase_IV_N UvrD-helicase AAA_19 UvrD_C UvrD_C_2 AAA_30 AAA_12 Viral_helicase1
Other DBs
NCBI-ProteinID: AET54308
Position
complement(1969437..1971491)
AA seq 684 aa
MELKATSLGKRLAQHPYDRAEILNAGVKVSGDRHEYLIPFNQLLAIHCKRGLVWGELEFV
LPEDKVVRLHGTEWSETQQFHRYLDAHWRRWSQEMSDVAAQALQEQWARISERTGGNQWL
TRERVRGLEHEIRQTFAALPLPVSRLEEFAHCREIWRKCLAWLQDSEGSRQQHNQAYADA
MLEAHADFFTQIESSPLNPSQARAVVNGESSLLVLAGAGSGKTSVLVARAGWLLARGQAD
AGQILLLAFGRKAAEEMDERIRERLHTEEITARTFHSLALYIIQQGSKKAPVVSKLESDA
TARHQLFLRTWRQQCSEKKAQAKGWRQWLEEEMQWVVPEGNFWDDETLQRRLAPRLDRWV
SLMRMHGGAQAEMIAGAPEECRELFGKRIKLMAPLLKAWKSALKAENAVDFSGLIHQAMV
ILEKGRFISPWKHILVDEFQDISPQRAALLEALRKQNSQTTLFAVGDDWQAIYRFSGAQL
SLTTAFHQTFGEGEHCHLDTTYRFNSRIGDIANRFVQQNPHQLKKPLNSLTPGDKKAVTL
LDESQLDALLDKLSGYAKEDERILVLARYHHLKPASLQKAATRWPKLQIDFMTIHASKGQ
QADYVILVGLQEGNDGFPAPARESIMESALLPQVEDFPDAEERRLLYVALTRARARVWLL
FNKDNPSRFVEALKQLDVPVARKP
NT seq 2055 nt   +upstreamnt  +downstreamnt
atggaactgaaagcaacttctcttggaaaacgtctggcgcaacacccgtatgatcgtgcc
gagatcctcaacgctggggtgaaagtgtctggcgacaggcatgaatatcttattccattc
aatcagttattggcgattcactgtaagcgtgggctggtatggggcgagctggagtttgtc
ctgccggaggataaagtcgtgcgtttgcacggtaccgagtggtcggaaacccagcaattc
catcgctatctggacgcgcactggcgtcgctggagccaggagatgagtgatgtcgccgcg
caggcattacaggagcaatgggcgcgtattagtgagcgaacgggcggaaaccaatggctt
acccgtgaacgcgttcgggggctggaacacgaaattcgccagacgtttgccgccttgccg
ctgccggtctcacgtctggaggagtttgctcactgtcgcgagatatggcgtaagtgtctg
gcatggttacaggatagcgagggaagtcggcagcagcataatcaggcgtatgctgatgcc
atgctggaagcgcatgccgacttttttacgcagatagaatcctctccgcttaatccttcc
caggccagggcggtggttaacggcgaatcatcgttactggtactggcgggcgcgggaagc
ggtaagacctcggtgctggtggcgcgcgcgggttggctgttggcgcgcggacaagccgat
gcggggcaaattcttttactggcgtttggtcgcaaggcggcagaagagatggatgagcgt
atccgcgagcgcttacatacggaagagattactgcccgtacgttccattcgctggcgctg
tatattattcagcaaggcagtaaaaaagcgccggttgtcagtaagctggaaagtgacgcc
accgcgcggcatcagctatttctgcgcacctggcgtcagcagtgtagcgagaaaaaagcg
caggccaaaggctggcgtcagtggctggaagaggagatgcagtgggtagtgccggaaggt
aatttctgggacgatgagacattgcagcggcgtctggcccctcgcctggatcgttgggtc
agtttgatgcgtatgcacggcggcgcgcaggcagaaatgatcgctggcgcgccagaggag
tgccgcgagctgtttggcaaacgcattaagctgatggcgccgctgctaaaggcctggaaa
agcgcgttgaaagcggaaaatgccgttgatttctccgggctgatccatcaggcaatggtg
atcctcgaaaaagggcgttttatcagcccgtggaagcatattctggtcgatgaatttcag
gatatttccccgcaacgggcggcgctgttagaggcgctgcgcaagcagaatagccagact
acgctgtttgccgttggcgatgactggcaggcgatttaccgttttagcggggcgcagctc
tccttaacgacggcgtttcatcagacgttcggcgagggcgagcattgccacctggacacc
acgtaccgctttaacagtcggattggcgatattgccaatcgctttgtacagcagaatccg
caccagcttaaaaaaccgttaaatagtctgaccccaggcgataaaaaagcggtgacgtta
ttggatgaaagccagttggacgcgttactggataaattatccggctatgcgaaggaagat
gaacgtatcctggtgctggcgcgctatcaccatctgaaacccgcgagtctacaaaaagcg
gcgactcgctggccgaagttacagatagacttcatgactatccatgccagcaaaggccaa
caggccgattacgtgattcttgtcggattgcaggagggtaacgacggtttccccgccccg
gcgcgagaatccattatggaaagtgcgcttcttcctcaggttgaggattttccggacgct
gaagagcggcgtttgttatatgtggcgttgacgcgcgcgcgtgcgcgggtctggctgctt
tttaataaagataatccctcgcgctttgtggaggcgcttaaacagctggatgtgccggtg
gcgaggaagccctaa

DBGET integrated database retrieval system