KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1981
Entry
SPUL_1981         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: YccF DUF5362
Other DBs
NCBI-ProteinID: AET54309
Position
1971615..1972061
AA seq 148 aa
MRTVLNILNFVLGGFATTLAWLLATLVSIVLIFTLPLTRSCWEITKLSLFPYGNEAIHVD
ELNPAAKSVLMNTGGTLLNIFWLLFFGWWLCLMHIASGIAQCVTIIGIPVGIANFKIAAI
ALWPVGRRVVSVETARAAREANARRRFE
NT seq 447 nt   +upstreamnt  +downstreamnt
atgcgtaccgttctgaatattttaaactttgtactgggcggctttgccactacgctggcc
tggctgctggcgacgcttgtcagtattgtgcttatttttaccctgccgttgacccgctcc
tgctgggagataaccaaactgtccctgttcccttacggtaatgaagccattcacgttgac
gaacttaatccggcggcgaaaagcgtattaatgaatactggcggtaccttgctgaatatt
ttctggttactttttttcggctggtggctatgcctgatgcacattgcctccggtatcgct
cagtgtgtcactatcatcgggatacctgtcggtattgcgaactttaaaattgccgcgatt
gcgctttggcctgtcggtcgccgcgtcgtctctgtagaaaccgctcgcgccgcgcgagaa
gctaacgcgcgccgccgttttgaatga

DBGET integrated database retrieval system