KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1982
Entry
SPUL_1982         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: FUSC-like FUSC_2 FUSC ALMT
Other DBs
NCBI-ProteinID: AET54310
Position
1972080..1974233
AA seq 717 aa
MLSPLIRRYTWNSTWLYYIRIFIALCGTTALPWWLGDVKLTIPLTLGMVAAALTDLDDRL
AGRLRNLIITLICFFIASASVELLFPWPWLFALGLTLSTSGFILLGGLGQRYATIAFGAL
LIAIYTMLGTSLYDHWYQQPLLLLAGAVWYNLLTLTGHLLFPIRPLQDNLARSYEQLAHY
LELKSRLFDPDIEDESQAPLYDLALANGQLMATLNQTKVSLLSRLRGDRGQRGTRRTLHY
YFVAQDIHERASSSHIQYQTLRDYFRHSDVMFRFQRLMSMQAQACTQLARCILLRTPYQH
DPRFERVFTHIDAALERMRASGASLELLNTLGFLLTNLRAIDAQLATIESEQAQAMPRNE
SENQLADDSLHGFSDIWLRLSRNFTPESALFRHAVRMSLVLCIGYALIQITGIRHGYWIL
LTSLFVCQPNYNATRHRLALRIIGTLVGVAIGLPILWFVPSLEGQLVLLVITGVLFFAFR
NVQYAHATMFITLLVLLCFNLLGEGFEVALPRVVDTLIGCAIAWAAVSFIWPDWRFRNLP
RVLQRATDANCRYLDAILEQYHQGRDNRLAYRIARRDAHNRDAELASVVSNMSSEPDVTA
ETREAAFRLLCLNHTFTSYISALGAHREKLSNPDVLGLLDDAVCYVDDALHHQPEDEQRV
HQALEGLKQRVQSLETRPDSKEPLVVQQIGLLIALLPEIGRLQRQISPPTSTLITQP
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgttaagtccgttgattcgccgttatacctggaacagtacctggctgtattacatccgc
atttttatcgctctgtgcggcaccaccgccctgccctggtggctgggcgacgtcaaactg
accatcccgctcacgctcggtatggttgccgcggcgctaaccgatctcgacgatcgcctt
gccggacgcttgcgtaatttaatcattaccttaatttgcttttttatcgcgtcggcttct
gtggagctgctctttccctggccgtggctatttgcgttgggcttaacgttatccaccagc
gggtttattctgttgggaggactggggcaacgctatgccaccatcgcgttcggcgcgtta
ctcattgccatctatacgatgctgggtacctctttatacgatcactggtatcagcaacca
ctgctcctgctggcaggcgcagtatggtataacctactgacgctaaccgggcatctgcta
tttccgatccgtccgttgcaggataatctggcacgcagttacgaacagttagcgcactat
ctggaactgaaatcacgtctgtttgatcctgatattgaagatgaaagccaggcgccgctc
tatgatttagcgttagcgaacgggcagttaatggcgacgctgaaccaaacgaaagtgtcg
ttattgagtcgcctgcgcggcgatcgcggtcaacgcggtacgcgccgcaccctccattac
tattttgtggcgcaggatattcatgaacgcgccagttcttcgcatattcaataccagaca
ctgcgcgattattttcgccatagcgacgtcatgttccgctttcagcgtctgatgtcgatg
caggcgcaggcctgtacgcagctggcgcgctgtatcttactgcgtacgccgtaccagcat
gatccgcgttttgaacgcgtctttacccacattgacgccgcgcttgaacgtatgcgcgcc
agcggcgcttctttagagctgctgaatacgcttggattcttattaaccaacctacgcgcc
attgatgcgcaactggcgacgatcgagtcggagcaggcccaggcaatgccgcgcaatgag
tcagaaaaccagttggctgatgatagcctgcacgggtttagcgacatctggctgcgtctg
agccgtaattttaccccggagtccgctctctttcgccatgcggtacgcatgtcgctggta
ttgtgcatcggttatgctctcatccaaattaccgggatacgccacgggtactggatattg
ctcaccagcctgtttgtttgccagcctaactataacgcgacccgccatcgccttgcgctc
aggattatcggcacgttggtaggcgttgctatcggcctgccgattttatggtttgttcct
tcgcttgaaggacagttagttctgctggtgattaccggcgtgcttttcttcgcattccgt
aatgtgcagtatgcccatgcaacgatgttcatcaccctgctggtattactctgctttaac
ctcctgggcgaaggcttcgaggtagcgttaccgcgcgtcgtcgacacgttaattggctgc
gctatcgcctgggctgcggtcagctttatttggccggactggcgctttcgcaaccttccc
cgggtactccagcgcgccaccgatgctaattgccgctaccttgatgcgatccttgagcaa
tatcaccagggacgggataaccgcctggcctatcgcattgccagacgcgacgcgcacaac
cgcgatgcagaactggcatccgtggtttctaatatgtcgagcgaacccgacgtcacggct
gaaacccgggaggcggcgttcaggctgctttgcctcaatcacacttttaccagctatatc
tccgccctcggcgcgcaccgcgaaaagctcagtaatccggacgtgttggggcttctggat
gacgcggtctgctacgttgatgatgcgcttcatcatcaacctgaagacgaacagcgcgta
caccaggcgctggagggtttaaagcagcgagttcagtcactggaaacacgtccggacagc
aaagaacctctggttgttcaacaaattggtttgctcattgccttactgcccgagattgga
cgcttgcaacggcaaatttcaccgccgacttctacattaattacccagccgtaa

DBGET integrated database retrieval system