KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1983
Entry
SPUL_1983         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K07343  DNA transformation protein and related proteins
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99993 Cell motility
    SPUL_1983
SSDB
Motif
Pfam: TfoX_C TfoX_N
Other DBs
NCBI-ProteinID: AET54311
Position
complement(1974220..1974825)
AA seq 201 aa
MRALSYDRIYKSQEYLASLGTIQYRSLFGSYSLTVEDTVFAMVANGELYLRACEESVPYC
VKHPPAWLMFMKCGRPVMLNYYRVDESLWRDQQQLVRLSKYSLDAAMKEKHSRILQHRLK
DLPNMTFHLETLLNESGIKDENMLRILGAKMCWLRLRQSNPLLTVKVLYALEGAIVGVHE
AALPASRRQELADWAHSLTAG
NT seq 606 nt   +upstreamnt  +downstreamnt
atgagagcactctcttatgacaggatctataaatcgcaagaatatttggcctctttgggg
acgatccagtatcgatctttattcggtagctatagtctgaccgtggaggataccgtcttt
gcgatggtggctaatggcgagctttatctccgcgcctgtgaagaaagcgtaccctactgt
gtgaagcatccccccgcctggctcatgtttatgaaatgtggacgtcccgttatgctcaac
tattaccgggtggatgaaagcctgtggcgcgatcagcagcagctggtacgtttatcgaag
tattctcttgacgcggcaatgaaggaaaaacacagccgtattttacagcacagactcaaa
gatcttcccaatatgaccttccatctggaaacattgctcaatgagtcagggataaaggac
gaaaatatgttacgcatactgggcgcgaaaatgtgctggctaaggttgcgacaaagcaat
cccttgctgacggtgaaagttttgtatgccctggaaggcgcaattgtcggcgtacatgaa
gcggcgctcccggcgagtcgtcgccaggagcttgccgactgggctcattcgcttacggct
gggtaa

DBGET integrated database retrieval system