KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1984
Entry
SPUL_1984         CDS       T01740                                 

Gene name
sulA
Definition
(GenBank) cell division inhibitor
  KO
K13053  cell division inhibitor SulA
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sel03036]
    SPUL_1984 (sulA)
Chromosome and associated proteins [BR:sel03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Inhibitors of FtsZ assembly
    SPUL_1984 (sulA)
SSDB
Motif
Pfam: SulA
Other DBs
NCBI-ProteinID: AET54312
Position
1975042..1975551
AA seq 169 aa
MYTSGYANRSSSFPTTTHNAARTATENAAAGLVSEVVYHEDQPMMAQLLLLPLLRQLGQQ
SRWQLWLTPQQKLSREWVQSSGLPLTKVMQISQLAPRHTLESMIRALRTGNYSVVIGWMT
EELTEEEHASLVEAAKVGNAVGFIMRPVRAHALSRRQHSGLKIHSNLYH
NT seq 510 nt   +upstreamnt  +downstreamnt
atgtacacttcaggttatgcaaatcgttcttcgtcatttcctaccactacccacaacgct
gcgcgcaccgctacggaaaatgccgcggcaggactggtcagtgaagttgtctaccacgaa
gaccagcccatgatggcgcaactcctgcttttgcctttactccgtcagttaggccaacaa
tcacgctggcagctctggctcacgccgcagcaaaagctcagccgtgaatgggtacagtct
tcaggtttgccattaacgaaagtgatgcaaattagccagcttgcgcctcgtcatacgctg
gagtcgatgatccgcgctttgcgtacaggaaattacagcgtggtaattggttggatgact
gaagaactgacagaagaagaacatgccagcctggttgaagcagcgaaggtaggtaatgcg
gtagggtttatcatgcgccctgtacgtgcgcacgctttatccaggagacagcattccggg
ctaaaaattcactctaatttgtatcattaa

DBGET integrated database retrieval system