KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1985
Entry
SPUL_1985         CDS       T01740                                 

Gene name
ompA
Definition
(GenBank) outer membrane protein A
  KO
K03286  OmpA-OmpF porin, OOP family
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sel02000]
    SPUL_1985 (ompA)
Transporters [BR:sel02000]
 Other transporters
  Pores ion channels [TC:1]
   SPUL_1985 (ompA)
SSDB
Motif
Pfam: OmpA_membrane OMP_b-brl OmpA DUF2490
Other DBs
NCBI-ProteinID: AET54313
Structure
PDB: 
4RHA 5VES 4ERH

Position
1975884..1976960
AA seq 358 aa
MDDNEAQKMKKTAIAIAVALAGFATVAQAAPKDNTWYAGAKLGWSQYHDTGFIHNDGPTH
ENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNINGAYKAQGVQLTAKLGYPITDDL
DVYTRLGGMVWRADTKSNVPGGPSTKDHDTGVSPVFAGGIEYAITPEIATRLEYQWTNNI
GDANTIGTRPDNGLLSVGVSYRFGQQEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKS
TLKPEGQQALDQLYSQLSNLDPKDGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISK
GIPSDKISARGMGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGVKDVVTQPQA
NT seq 1077 nt   +upstreamnt  +downstreamnt
ttggatgataacgaggcgcaaaaaatgaaaaagacagctatcgcgattgcagtggcactg
gctggtttcgctaccgtagcgcaggccgctccgaaagataacacctggtacgctggtgct
aaactgggctggtctcagtaccatgacaccggcttcattcacaatgatggcccgactcat
gaaaaccaactgggcgcaggtgcttttggtggttaccaggttaacccgtatgttggcttt
gaaatgggctacgactggttaggccgtatgccgtacaaaggcgacaacatcaatggcgct
tataaagctcagggcgttcagttgaccgctaaactgggttatccaatcactgacgatctg
gacgtttatacccgtctgggtggtatggtatggcgtgcagacaccaagtctaatgtccct
ggcggcccgtctactaaagaccacgacaccggcgtttccccggtattcgcgggcggtatc
gagtatgccatcacccctgaaatcgcaacccgtctggaataccagtggactaacaacatc
ggtgatgccaacaccatcggcacccgtccggacaacggcctgctgagcgtaggtgtttcc
taccgtttcggccagcaagaagctgctccggtagtagctccggcaccggctccggctccg
gaagtacagaccaagcacttcactctgaagtctgacgtactgttcaacttcaacaaatct
accctgaagccggaaggccagcaggctctggatcagctgtacagccagctgagcaacctg
gatccgaaagacggttccgttgtcgttctgggcttcactgaccgtatcggttctgacgct
tacaaccagggtctgtccgagaaacgtgctcagtctgttgttgattacctgatctccaaa
ggtattccgtctgacaaaatctccgcacgtggtatgggcgaatctaacccggttaccggc
aacacctgtgacaacgtgaaacctcgcgctgccctgatcgattgcctggctccggatcgt
cgcgtagagatcgaagttaaaggcgttaaagacgtggtaactcagccgcaggcttaa

DBGET integrated database retrieval system