KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1987
Entry
SPUL_1987         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K04770  Lon-like ATP-dependent protease [EC:3.4.21.-]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sel01002]
    SPUL_1987
Enzymes [BR:sel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     SPUL_1987
Peptidases and inhibitors [BR:sel01002]
 Serine peptidases
  Family S16: lon protease family
   SPUL_1987
SSDB
Motif
Pfam: AAA_32 Lon_C
Other DBs
NCBI-ProteinID: AET54315
Position
1977670..1979430
AA seq 586 aa
MTITKLAWRDLVPDSESYQEIFAQPHATDENDTLLSDTQPRLQFALEQLIQPWASSSFML
TKAPEEQEYLTLLSDAVRALQTDAGQLTGGHYDVSGHTVHYRAAQNAQDNFATVTQVVSA
DWVEAEQLFGCLRQYNGDIILQPGLVHQANGGVLIISLRTLLAQPLLWMRLKAIVSRERF
DWVAFDESRPLPVSVPSMPLKLKVILVGERESLADFQEMEPELAEQAIYSEFEDNLQIAD
AEAMTLWCQWVTRIALRDNLPPPAPDAWPVLIREAVRYTGEQDTLPLCPLWIARQFKEAS
PLCEGDTCGAEALSLMLARREWREGFLAERMQDEILQEQILIETEGERVGQINALSVIEF
PGHPRAFGEPSRISCVVHIGDGEFNDIERKAELGGNIHAKGMMIMQAFLMSELQLEQQIP
FSASLTFEQSYSEVDGDSASMAELCALISALANVPVNQNIAITGSVDQFGRAQPVGGLNE
KIEGFFAICEQRELNGKQGVIIPAANVRHLSLKSELLQAVKEEKFTIWAVDDVTDALPLL
LNLVWDGEGQTTLMQTIQERIAQATQQEGRHRFPWPLRWLNAFIPN
NT seq 1761 nt   +upstreamnt  +downstreamnt
ttgaccattacgaaacttgcatggcgtgatctggttccggatagcgaaagctatcaggag
atatttgcacagccacacgcgactgacgaaaacgacaccttactcagtgatactcagcca
cgactgcaatttgcgcttgagcaacttatacagccgtgggcatcatcctcttttatgctg
actaaagcgcctgaagagcaagagtatctcactttactttcagatgccgtccgcgctctg
caaaccgatgccggacaattaaccggcggacattatgacgtttccgggcatactgttcat
taccgcgccgcgcagaatgcgcaagacaactttgccaccgtcacacaagtcgtcagcgcg
gactgggtcgaagccgaacagctctttggttgcctgcggcagtataacggcgacattatc
ctgcagccgggactggttcatcaggcgaacggcggcgtgctgattatttccttacgaacc
cttctggcgcagccgttactgtggatgcgtctgaaagccatcgttagccgcgagcgtttt
gactgggtggcctttgacgagtcgcgtccattaccggtctccgtgccatcaatgccgctc
aaactgaaggtgattctggttggcgaacgtgaatcactggctgattttcaggagatggaa
ccggagctcgcggaacaggctatctacagtgaatttgaagacaatttacagatagcggac
gcagaagctatgaccctgtggtgtcaatgggtgacgcgtatcgctttacgcgataatttg
ccccctccggcaccggacgcctggcccgtcctgatacgcgaggctgtgcgctataccggc
gaacaggatacgctgcctctttgcccactgtggatagcccgccagtttaaggaggcgtcg
cctttatgcgaaggcgatacctgcggcgcagaagcgctcagcctgatgcttgcccgacgc
gaatggcgagaaggctttctggcggagcggatgcaggatgagattctgcaagagcagatc
ctgattgaaaccgaaggcgaacgcgttggacaaatcaatgcgctttccgtcattgagttt
cccgggcatccgcgcgcctttggcgaaccgtcgcgaattagctgtgttgtgcatatcggc
gatggcgaatttaacgatattgagcgcaaggccgaacttggcgggaatatccacgctaag
ggaatgatgattatgcaggccttcctgatgtcggagttgcagctggagcaacaaattccc
ttctctgcctcgttaacctttgagcagtcctacagcgaagtggatggcgatagcgcctca
atggcggaattatgtgcgctcatcagcgcgctggccaatgtgccggtgaatcaaaacatt
gcgattaccggctcggtcgatcagtttggtcgcgcgcaaccggtgggtgggctaaacgaa
aaaattgaaggtttcttcgccatctgcgagcagcgggaattaaacggtaaacagggcgtg
attatccctgcagccaatgtccgccatctcagtcttaaatctgaactgctgcaagcggtt
aaagaagagaagttcactatctgggcggtagacgacgtgaccgacgccttaccgctactg
ttaaatctggtgtgggatggcgaaggtcaaacgacgttgatgcagactatccaggagcgt
atcgcgcaggcgacgcaacaggaaggccgtcatcgtttcccgtggccattacgttggctg
aacgcttttattccgaactga

DBGET integrated database retrieval system