KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1988
Entry
SPUL_1988         CDS       T01740                                 

Gene name
fabA
Definition
(GenBank) D-3-hydroxydecanoyl-(acyl carrier-protein)
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00061  Fatty acid biosynthesis
sel01100  Metabolic pathways
sel01212  Fatty acid metabolism
Module
sel_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SPUL_1988 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sel01004]
    SPUL_1988 (fabA)
Enzymes [BR:sel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     SPUL_1988 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     SPUL_1988 (fabA)
Lipid biosynthesis proteins [BR:sel01004]
 Fatty acid synthase
  Component type
   SPUL_1988 (fabA)
SSDB
Motif
Pfam: FabA
Other DBs
NCBI-ProteinID: AET54316
Position
1979499..1980017
AA seq 172 aa
MVDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELD
INPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLP
TARKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTAHDLKVGLFQDTSAF
NT seq 519 nt   +upstreamnt  +downstreamnt
atggtagataaacgcgaatcctatacaaaagaagaccttcttgcctctggtcgtggtgaa
ctgtttggcgctaaagggccgcaactccctgcgccgaacatgctgatgatggaccgcgtc
gttaagatgaccgaaacgggcggcaatttcgacaaaggctatgtcgaagccgagctggat
atcaatccggatctatggttcttcggatgccactttatcggcgatccggtgatgcccggt
tgtctgggtctggatgctatgtggcaattggtgggattctacctgggctggctgggcggc
gaaggcaaaggccgcgctctgggcgtgggcgaagtgaaatttaccggccaagttctgccg
acagccaggaaagtcacctatcgtattcatttcaaacgtatcgtaaaccgtcgcctgatc
atgggcctggcggacggtgaggttctggtggatggtcgtctgatctataccgcacacgat
ttgaaagtcggtttgttccaggatacttccgcgttctaa

DBGET integrated database retrieval system