KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1989
Entry
SPUL_1989         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Other DBs
NCBI-ProteinID: AET54317
Position
1980448..1980585
AA seq 45 aa
MSHNNYFSGVKNKKTASGARPEAVKFTLLLSQGRRFISSAIAAAS
NT seq 138 nt   +upstreamnt  +downstreamnt
gtgagccataacaactatttttccggcgtcaaaaataaaaaaaccgcctcaggcgcacga
cctgaagcggttaaatttacattacttttatctcagggaaggcgctttatctcatctgcg
atagcggctgcttcctga

DBGET integrated database retrieval system