KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1990
Entry
SPUL_1990         CDS       T01740                                 

Gene name
ymbA
Definition
(GenBank) putative lipoprotein
  KO
K09857  uncharacterized protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SPUL_1990 (ymbA)
SSDB
Motif
Pfam: ABC_trans_aux
Other DBs
NCBI-ProteinID: AET54318
Position
complement(1980540..1981103)
AA seq 187 aa
MKKWLVVIMAFWLASCSSGGENKSYYQLPIAQSGVQSTASQGNRLLWVEQVSVPDYLAGN
GVVYQTSDVQYVIANNNLWASPLDQQLRNTLVANLSARLPGWVVASQPLGTTQDTLNVTV
TGFHGRYDGKVIVSGEWLLNHNGQLIKRPFHIEASQQKDGYDEMVKVLASAWSQEAAAIA
DEIKRLP
NT seq 564 nt   +upstreamnt  +downstreamnt
atgaaaaaatggctagtcgtgataatggcgttctggctggcgtcatgtagctccggcgga
gagaataaaagctattatcagctcccgatagcgcaaagcggtgtgcaaagcaccgcaagc
cagggcaaccgtctcttatgggtagagcaggtttccgtacctgactatctggcaggtaac
ggcgtggtgtatcaaaccagtgatgttcagtatgtgattgccaataacaatctgtgggcc
agcccgctggaccagcaattacgtaacacgctggtggcgaatcttagcgcccggcttcct
ggctgggtcgtcgcttcccagccgttgggaaccacccaggatacgttaaacgttaccgta
accggattccatggacgctacgatggtaaggttatcgtcagcggggagtggttattaaac
cacaatggacagctgattaagcggcctttccatatcgaagccagtcagcagaaagatggc
tatgatgagatggtcaaagtactggcaagcgcatggagtcaggaagcagccgctatcgca
gatgagataaagcgccttccctga

DBGET integrated database retrieval system