KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1991
Entry
SPUL_1991         CDS       T01740                                 

Gene name
pqiB
Definition
(GenBank) putative secreted protein
  KO
K06192  paraquat-inducible protein B
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    SPUL_1991 (pqiB)
SSDB
Motif
Pfam: MlaD DHC_N2 DUF948 DASH_Duo1 BLOC1_2 EzrA GCP_N_terminal LemA DHR10 FUSC DUF773
Other DBs
NCBI-ProteinID: AET54319
Position
complement(1981100..1982740)
AA seq 546 aa
MEPKKGEAKVQKVKNWSPVWIFPIVTALIGAWILFYHYSHQGPEVTLITTNAEGIEGGKT
TIKSRSVDVGVVESATLTDDLTHVQIKARLHSGMEKLLHKDSVFWVVKPQVGREGISGLG
TLLSGAYIELQPGSKGSQPESYQLLDSPPLAPPDAKGIRVILDSKKAGQLSPGDPVLFRG
YRVGSVETSSFDPQKRTMSYQLFIKAPNDRLVTSNVRFWKDSGIAVDLTSAGMRVEMGSL
TTLFGGGVSFDVPEGLEQGQPVAEKTAFNLYDDQKSIQDSLYTDHIDYLMFFKDSVRGLQ
PGAPLEFRGIRLGTVSKVPFFASKMRQVFNDDYRIPVLVRIEPERLKAQLGENADVGAHL
TELLKRGLRASLKTGNLVTGALYVDLDFYPKEPPITGLREFDGYEIIPTVSSGLAQIQQR
LVETLDKINNLPLNPMIEQATNTLSESQRTMRRLQTTLDNMNKITSSQSMQQLPADMQTT
LRELNRSMQGFQPGSAAYNKMVADMQRLDQVLRELQPVLKTLNEKSNALVFEAKDKKDPE
PKRAKQ
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggaacctaaaaaaggggaagccaaagtacaaaaggtgaaaaattggtcgcctgtctgg
atattcccgattgttactgcgcttatcggagcctggattctgttttatcactacagccac
cagggaccggaagttaccttaatcaccaccaatgcggaaggcattgaaggcggaaaaacg
acgatcaaaagtcgcagcgtggatgttggcgtggttgaaagcgcgacgctgactgacgat
ctgacccacgtacaaatcaaagcgcggctccattccggtatggaaaagttgctgcataaa
gactcggtattttgggtggtaaaaccgcaggtggggcgtgaaggcatcagcgggcttggg
acgctgctatcaggtgcgtatattgaactacaaccaggaagtaagggcagtcagccggaa
agctatcagcttcttgactcaccgccgttggcgccgcccgatgccaaaggtattcgtgtg
attctggacagcaaaaaggccggtcagctcagtcctggcgatcccgttctgttccggggc
tatcgggtagggtccgttgaaaccagctctttcgatccgcaaaaacggacaatgagttat
cagttgttcattaaggcgccaaacgatcggttggtcaccagtaatgtccgattctggaaa
gatagcggtatcgctgtggatctgacatcggcgggaatgcgcgtggaaatgggatcgttg
acgacgttgtttggcggcggcgtgagttttgatgtgccggaaggacttgagcaggggcaa
cccgtcgccgaaaaaacggcgtttaatctctacgacgatcaaaaaagtattcaggattcg
ctgtataccgatcatatcgattacctgatgttctttaaagattctgtgcgcggattacaa
cccggcgcgccgctggagttccgcggtattcgtctggggacggtaagcaaagtgcctttc
tttgcgtctaaaatgcgccaggtatttaacgacgattaccgtattcctgtgctggtgcgc
attgaaccggagcgtctgaaagcgcaattgggagaaaatgcggatgttggcgcgcatttg
acggaactgcttaagcgcggtttacgcgcttcgcttaaaaccggtaacctggtgaccggg
gcgctgtatgtcgatctggacttttatcctaaggagccgccgattaccgggctacgcgaa
tttgatggttatgaaattattcccaccgtcagcagcggcctggcgcaaattcaacagcga
ctggtggaaacgttggataagatcaacaacctgccgctgaatccgatgattgaacaagcg
accaatacgctgtctgaaagccagcgtactatgcgtcggctgcaaaccacgctggataat
atgaacaagattacctccagtcagtcgatgcagcagcttccggcggatatgcaaacgacg
ttacgcgaacttaaccgcagtatgcagggcttccagcctggatcggcggcgtataacaaa
atggtggcggatatgcagcgtctcgatcaggtgcttcgtgagttacaaccggtgttgaaa
actctgaacgagaagagcaacgcgctggtatttgaagcgaaggataaaaaagatcctgag
cctaagagggcgaaacaatga

DBGET integrated database retrieval system