KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1992
Entry
SPUL_1992         CDS       T01740                                 

Gene name
pqiA
Definition
(GenBank) putative inner membrane protein
  KO
K03808  paraquat-inducible protein A
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    SPUL_1992 (pqiA)
SSDB
Motif
Pfam: PqiA
Other DBs
NCBI-ProteinID: AET54320
Position
complement(1982745..1983818)
AA seq 357 aa
MLLLSNLFPFVNMNVAGVTSEVTLLEIPGVMFSEDYASLGTFFLLFVQLVPAFCLVTILL
LVNRASLPLSVKKTLARIFFLLKSWGMAEIFLAGVLVSFVKLMAYGDIGIGSSFIPWCLF
CLVQLRAFQCVDRRWLWDDIAPQPALAQPLTPGITGIRQSLRSCACCTAILPAESLVCPR
CHTKGYVRRKNSLQWTLALLFTSIMLYLPANILPIMITDLLGSKMPSTILAGVILLWSEG
SYPVAAVIFLASIMVPTLKMIAIAWLCWDAKGHGKRDSERMHFIYEVVEFVGRWSMIDVF
VIAVLSALVRMGGLMNIYPAMGALMFALVVIMTMFSAMTFDPRLSWDREYEPGHEES
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgttgctgctttctaacctttttcccttcgtgaatatgaatgtcgcgggcgtcaccagc
gaagtcacgcttctggaaatccccggcgtcatgttttctgaagattacgccagcctcggc
acgttctttttattatttgtccaactggtgccggcattttgcctggtgactattctatta
cttgtcaaccgcgccagtctgccgttgtcggtaaaaaaaacgctggcaaggatctttttc
ctcctcaaatcgtggggaatggcggaaatatttctcgccggggtgttggtcagttttgtt
aagctgatggcctacggcgatatcggcatcggcagcagctttattccctggtgcttattt
tgtctcgttcaactgcgggcgttccagtgtgtcgatcgccgctggttgtgggatgatatc
gccccgcagcctgcactggcgcagccgttaacgccggggattaccggtatccggcagtct
ttgcgttcttgcgcctgctgtacggcgatcctgcctgcggagagtctcgtctgtccgcgt
tgccatacgaaaggctatgtccggcgtaaaaacagtttgcagtggacgctggcgttatta
tttacctcgatcatgctttatctgcccgccaatattttgccgattatgattaccgactta
ctgggctcgaaaatgccgtcgaccattctggctggcgtgattttgctgtggagcgagggg
tcttatccggtggcggcggttatctttctcgccagtattatggtgccgacgctaaaaatg
atcgccattgcttggctttgttgggatgcgaaaggccacggtaagcgcgacagtgaacgg
atgcattttatttatgaagtagtggagtttgtggggcgctggtcaatgattgatgtcttt
gtcattgccgtactctctgcgctggtgcgtatgggagggttaatgaatatttatcctgcg
atgggtgcgttgatgtttgctttagtcgtcataatgacaatgttttctgcgatgaccttt
gatccgcgtctgtcgtgggatcgtgagtacgaaccaggccatgaggagtcctga

DBGET integrated database retrieval system