KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1995
Entry
SPUL_1995         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K07140  uncharacterized protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SPUL_1995
SSDB
Motif
Pfam: MOSC MOSC_N Fer2 Ala_racemase_C
Other DBs
NCBI-ProteinID: AET54323
Position
1988140..1989249
AA seq 369 aa
MATLSRLFIHPVKSMRGIGLTHALADISGLAFDRIFMVTEPDGTFITARQFPQMVRFTPS
PLHDGLHLTAPDGSRALVRFTDFTPQDAPTEVWGNHFTARVAPTAINQWLSGFFSRDVQL
RWVGPQLTRRVKRHNAVPLGFADGYPYLLTNEASLRDLQQRCPAGVQMEQFRPNLVVSGV
AAWEEDSWKVLRIGDVIFDVVKPCSRCIFTTVSPEKGQKHPSGEPLATLQAFRTAQDNGD
VDFGQNLIARNSGVVRVGDEVEILATAPAKAYGATTVDDSVTPDKHPDASVTIDWQGQTF
CGNNQQVLLEQLENQGIRIPYSCRAGICGCCRIRLLEGEVSPLKKSAMGDDGTILSCSCV
PKTALRLEN
NT seq 1110 nt   +upstreamnt  +downstreamnt
gtggcgacattatcacggctctttattcatccggtcaaatccatgcgcggcattggcctg
actcatgcgctggcagatatcagcggcctggcttttgatcgcatcttcatggtgaccgag
cctgacggcacatttattaccgcccgccagtttccacaaatggtacgttttaccccttct
cccttacacgacggcctccatttgaccgcgccagacggcagtagagcgctggttcgcttt
acggatttcaccccgcaggatgcgccgaccgaggtctggggaaaccattttaccgctcgc
gtcgccccgacggcgattaatcaatggttgagcggctttttctcccgcgatgtccagttg
cgctgggttgggccgcagttgacgcgccgggtcaaacgacataacgcggtgccgctggga
tttgccgatggctacccgtatttattgaccaacgaagcctcgctgcgcgatctgcaacag
cgttgtccggcaggcgtacaaatggaacaatttcgcccaaacttagtggtttccggcgta
gcggcctgggaggaagatagctggaaagtgcttcgcattggcgatgtgatttttgacgtc
gtgaagccctgtagccgctgtatttttacaaccgtcagccctgaaaaggggcaaaaacat
ccttccggagaaccgctggcgacactgcaagcttttcgtaccgcccaggacaatggcgat
gtggatttcggtcagaatctgattgcccgcaatagcggcgtcgttcgcgtcggcgatgaa
gtggagattctggcgacagctccggcaaaagcttatggcgccacaacggtcgacgacagc
gttacgccagataaacacccggacgcgagtgtaaccatcgactggcaggggcaaaccttc
tgcgggaataatcaacaggtactactggaacagttggagaatcaggggattcgtattccg
tattcttgccgggctggtatctgtggttgctgccggatacgtttgctggaaggcgaagta
agtccgctgaaaaaatcggctatgggtgacgatggtacgattctgagctgtagctgcgtg
cctaagaccgcgttacgactggagaattaa

DBGET integrated database retrieval system