KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1996
Entry
SPUL_1996         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K18657  cell division protein ZapC
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sel03036]
    SPUL_1996
Chromosome and associated proteins [BR:sel03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    SPUL_1996
SSDB
Motif
Pfam: ZapC
Other DBs
NCBI-ProteinID: AET54324
Position
complement(1989246..1989788)
AA seq 180 aa
MRIKPDDNWRWYYDEEHDRMMLDLANGILFRSRFSRKMLTPDAFCPTGFCVDDAALYFSF
EEKCRDFELTKEQRAELVLNALVAIRYLKPQMPKSWHFVAHGEMWTPGTGDAASVWLSDT
AEQVNLMVVEPGENAALCLLAQPGVVIAGRTMQLGDAIKIMNDRLKPQVHCHSFSLEQAV
NT seq 543 nt   +upstreamnt  +downstreamnt
atgcgaattaaacctgacgataactggcgctggtattatgatgaagagcacgatcgtatg
atgctcgatctcgccaatggtatactttttcgctcgcgcttctctcgtaaaatgcttacg
ccggacgcgttttgcccgaccggtttttgtgtggatgatgccgcgctctatttttccttt
gaagaaaaatgccgggatttcgaattaaccaaagagcaacgcgcggagctggtgttgaat
gcgctggtggcgattcgctatctcaaaccgcagatgccaaaaagctggcattttgtagcg
catggcgaaatgtggaccccaggaacgggcgatgccgcaagcgtctggttaagcgatacg
gcggaacaggttaatttgatggtcgttgagccgggagaaaatgccgcgttgtgtctgctg
gcccagccgggcgtggtgatagcaggccgaaccatgcagcttggcgatgcgattaaaatt
atgaacgacaggctgaaaccgcaggttcactgtcacagtttcagccttgaacaagcggtt
taa

DBGET integrated database retrieval system