KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1997
Entry
SPUL_1997         CDS       T01740                                 

Gene name
pyrD
Definition
(GenBank) dihydroorotate dehydrogenase
  KO
K00254  dihydroorotate dehydrogenase [EC:1.3.5.2]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00240  Pyrimidine metabolism
sel01100  Metabolic pathways
Module
sel_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPUL_1997 (pyrD)
Enzymes [BR:sel01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.2  dihydroorotate dehydrogenase (quinone)
     SPUL_1997 (pyrD)
SSDB
Motif
Pfam: DHO_dh PEP_hydrolase
Other DBs
NCBI-ProteinID: AET54325
Position
complement(1989954..1990964)
AA seq 336 aa
MYYPFVRKALFQLDPERAHEFTFQQLRRITGTPLEALVRQKVPTKPVTCMGLTFKNPLGL
AAGLDKDGECIDALGAMGFGSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGV
DNLVENVKKAHFDGILGINIGKNKDTPVENGKDDYLICMEKVYAYAGYIAINISSPNTPG
LRTLQYGDALDDLLTAIKNKQNDLQAIHHKYVPVAVKIAPDLCEEELIQVADSLLRHNID
GVIATNTTLDRSLVQGMKNCQQTGGLSGRPLQLKSTEIIRRLSQELKGQLPIIGVGGIDS
VIAAREKIAAGATLVQIYSGFIFKGPPLIKEIVTHI
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgtactatcccttcgttcgtaaagcccttttccagctcgatccagagcgcgctcatgaa
tttacatttcaacaattacgccgcattacaggtacgccgctggaagcgctggtgcgccag
aaagtaccgacaaagccggttacctgcatgggacttacctttaaaaatccactggggctg
gctgccggtctggataaagacggggagtgcatcgacgcgttaggcgcgatggggtttggc
tccctggaaatcggcaccgtgacgccgcgcccacagccgggtaacgataagccgcgtctt
tttcgtctggtggatgctgaaggtctgatcaatcggatgggctttaataatctgggcgtc
gataacctggtcgagaatgttaaaaaagcccattttgatggtattctgggaattaacatc
ggtaaaaataaagatacgcctgtcgaaaatggcaaagatgactacctgatttgtatggaa
aaagtctatgcttatgcgggttatatcgccattaatatttcttcgccgaatacgccaggg
ctacgtacgctccagtatggcgatgcgctggacgatctgttaactgccattaaaaataag
caaaacgatcttcaggcgatccaccataaatatgtgccggtggcagtaaagatcgcgccg
gatctttgtgaagaagaattgatccaggttgccgatagcctgcttcgtcataatattgat
ggggtgattgcgacaaataccaccctcgatcgttctctggtacaaggaatgaaaaattgc
cagcaaacggggggattaagtggccggccattacaattaaaaagcacagaaattattcgc
cgtttatcccaggagttaaagggacaattgcctattatcggcgtcggcggcattgactca
gttatcgccgcgcgcgagaagatagcggcaggagctacgctggtacaaatttattccggc
tttatttttaaaggcccgccattgattaaagaaatcgtaacgcacatctaa

DBGET integrated database retrieval system