KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_1999
Entry
SPUL_1999         CDS       T01740                                 

Gene name
pncB
Definition
(GenBank) nicotinate phosphoribosyltransferase (naprtase)
  KO
K00763  nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00760  Nicotinate and nicotinamide metabolism
sel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SPUL_1999 (pncB)
Enzymes [BR:sel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.21  nicotinate phosphoribosyltransferase
     SPUL_1999 (pncB)
SSDB
Motif
Pfam: NAPRTase NAPRTase_N HBS1_N
Other DBs
NCBI-ProteinID: AET54327
Position
1994051..1995253
AA seq 400 aa
MTQFASPVLHSLLDTDAYKLHMQQAVFHHYYDVQVAAEFRCRGDDLLGIYADAIREQVDA
MQHLRLQEDEFQWLSGLPFFKPDYLNWLREFRYNPAQVCVTNDNGKLNIRLTGPWREVIM
WEVPLLAVISELVHHYRSPNAGVDQALDALESKLVDFTALTANLDMSRFHLMDFGTRRRF
SREVQQAIVKRLQQESWFVGTSNYDLARRLALTPMGTQAHEWFQAHQQISPDLATSQRAA
LAAWLNEYPDQLGIALTDCITMDAFLRDFGIEFASRYQGLRHDSGDPVAWGEKAIAHYEK
LGIDPLTKTLVFSDNLDLPKAVELYRHFASRVQLSFGIGTRLTCDIPQVKPLNIVIKLVE
CNGKPVAKLSDSPGKTICHDKAFVRALRKAFDLPQVRKAS
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgacacaattcgcttctcctgttctgcactcgttgctggatacagatgcttataagttg
catatgcagcaagccgtttttcaccactactatgatgtgcaggtagcggctgagtttcgt
tgccgtggcgacgacctgctgggtatttatgccgatgctattcgcgagcaggtggacgcg
atgcagcacctgcgcctccaggaggacgagttccagtggctctccggcctgccctttttt
aaaccggattatctgaactggttacgcgagtttcgctataacccagctcaagtctgtgtc
accaacgataacggcaagctgaatattcgcttaaccggcccgtggcgtgaagtcattatg
tgggaagtgccgctgctggccgtgatcagtgagctggttcatcactaccgctcgccaaac
gcgggcgttgatcaggcgctcgacgcgctggaaagtaagctggttgatttcactgcgtta
accgccaatctcgatatgtcccgcttccacctgatggacttcggcacccgccgccgtttc
tctcgtgaagtgcagcaggcgatagttaaacgtctccagcaggagtcatggttcgtcggc
accagcaactatgatctcgcgcgtcgcctggcgctgacgccgatgggcactcaggcgcac
gaatggttccaggcgcatcaacaaatcagtccggacctggcgaccagccagcgtgccgcg
ttggccgcctggcttaacgaatatccggaccagcttggtatcgccttgacagattgcatt
acaatggatgcgtttttacgcgatttcggcattgaattcgccagccgttatcaggggtta
cgccacgactcaggagaccctgtcgcatggggcgaaaaggcgattgcccattatgaaaag
ctggggattgatccgctgacaaaaacgctggtcttttcagataaccttgatctgccaaag
gcggtcgagctctatcgccatttcgcctctcgcgtgcagttaagcttcggcatcggtacc
cgcctgacctgcgatatccctcaggtaaaaccgctcaatatcgtgattaagctcgtggaa
tgtaacggaaagccggtggctaaactttccgacagccccggtaaaacgatctgtcatgat
aaagcgtttgtgcgcgcgctgcgtaaagcgttcgatctcccgcaggtgcgtaaagcaagt
taa

DBGET integrated database retrieval system