KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2000
Entry
SPUL_2000         CDS       T01740                                 

Definition
(GenBank) putative ion:amino acid symporter
  KO
K03310  alanine or glycine:cation symporter, AGCS family
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SPUL_2000
SSDB
Motif
Pfam: Na_Ala_symp AA_permease_2
Other DBs
NCBI-ProteinID: AET54328
Position
complement(1995331..1996767)
AA seq 478 aa
MLEQLSQLFEFLWGGPLFLCVIGIGFYFTVRLKFFQIINLKEIYRNTIGTLAGKNKQNTT
GEAASKKSLKSIEVAATVLSGSLGAGTIAGVAAAIAVGGPGAIFWMWIIAVVGMMTKMVE
VTLAVKYRSKGENGEYYGGPMHYIKKGLNKKWHPLAGLYAFALMILVITDVCFVQTNTMA
AVIHYTFEIPTSVIGGFIVIVGALVILKGLSSLGKFCTIALPPITIAYFIGAAGVVVLNI
EAIPQVIKSIFYYAFAPAPAVGGFVGSTIMMAISKGASRGIFTNEAGMGTSATVHATANV
DYAFRQGMWGAVEVFFVSMITCNFTAFAVLASGMWTDASYQGIQIIFAALKETWHPIIVQ
VLCLGVALILFTSYLGSYIKFRTSINYIFGDKLERIIKWLYFLPPLIAVNMEIPVIWLMA
DIAVGFLVIPNVIALFLLRKEFISEFNLFRTRTQRDTHSEKTTQITHVNMSKSEGKEE
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgttagagcaactttcacaactctttgaatttctatggggtggcccattatttttgtgt
gttatcggcattggcttttatttcacagtacgcctcaaatttttccagattatcaattta
aaagaaatttaccgtaatacaattggtacacttgccggaaaaaataaacaaaacactact
ggcgaggcagcgtctaaaaaatccttaaaatcaatagaggtggctgccactgtgctatcc
ggctcattaggcgcgggaacgatcgcaggtgttgctgcggctattgcggttggcggacct
ggggcaattttctggatgtggatcattgcggtcgtgggtatgatgaccaaaatggttgaa
gtgacgctggcggtgaaataccgaagtaaaggtgagaatggcgaatattatggcggccca
atgcattatattaagaaagggctcaataaaaaatggcatcccctggcaggattatatgcg
tttgcattaatgattctggttattacggatgtctgttttgtgcaaactaatacgatggcg
gcggtcattcactatacgtttgaaatcccaacaagcgtcatcgggggatttattgtcatc
gtaggcgcgttggttattttaaaaggactctccagtcttggtaaattctgtacgattgca
cttccaccgatcaccattgcctatttcattggtgccgctggtgtagtggtattgaatatc
gaggctatcccacaggttataaaaagtattttctattatgcctttgcccctgcgccagca
gtcggtggctttgtcgggtcaaccatcatgatggccatcagtaaaggagccagtcgcgga
atattcactaacgaagccggcatgggtacctcggccacagtacatgctactgccaacgtg
gattatgctttccgtcagggaatgtggggggcagtggaagtattttttgtctcaatgatt
acctgtaactttaccgcatttgctgtacttgcttctggtatgtggacagatgccagttat
caaggtattcagattatctttgccgccttaaaagaaacatggcatccgattattgttcag
gttctctgtctcggtgtggcgttgattctgtttacttcttatcttggttcatatattaaa
tttcgcacttcgataaactatatctttggcgataagctagaacgcatcattaaatggcta
tattttttgccgccactgattgccgttaatatggaaatcccggtaatctggttaatggct
gatattgctgtcggttttctggttatccccaacgtaattgctctgttcttgctgcgtaaa
gaatttattagcgaattcaatttattcagaacgcgtacacagcgggacactcattctgaa
aaaacaacgcaaattacgcacgtaaatatgtcgaagagtgaagggaaagaggagtaa

DBGET integrated database retrieval system