KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2003
Entry
SPUL_2003         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Other DBs
NCBI-ProteinID: AET54331
Position
1998326..1998481
AA seq 51 aa
MVILTLINRTDKRAAQYLLRPFLYSTDYDSTMLIAVKWRENAHRRAIFTFF
NT seq 156 nt   +upstreamnt  +downstreamnt
gtggttatcctcactttaataaaccgtactgataaaagagccgcacaatatctattacgt
ccttttctttattccactgattatgatagtactatgcttattgctgttaaatggcgcgaa
aatgcccatcgtcgtgcaattttcacctttttttaa

DBGET integrated database retrieval system