KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2005
Entry
SPUL_2005         CDS       T01740                                 

Gene name
asnS
Definition
(GenBank) asparaginyl-tRNA synthetase
  KO
K01893  asparaginyl-tRNA synthetase [EC:6.1.1.22]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sel00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPUL_2005 (asnS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sel01007]
    SPUL_2005 (asnS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sel03016]
    SPUL_2005 (asnS)
Enzymes [BR:sel01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.22  asparagine---tRNA ligase
     SPUL_2005 (asnS)
Amino acid related enzymes [BR:sel01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   SPUL_2005 (asnS)
Transfer RNA biogenesis [BR:sel03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SPUL_2005 (asnS)
 Prokaryotic type
    SPUL_2005 (asnS)
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d tRNA_anti_2 RecJ_OB
Other DBs
NCBI-ProteinID: AET54333
Position
1999207..2000607
AA seq 466 aa
MSVVPVADVLQGRVAVDQEVTVRGWVRTRRDSKAGISFLAVYDGSCFDPVQAVINNSLPN
YNEEVLHLTTGCSVVVTGKVVASPGQGQSFEIQATKVEVAGWVEDPDTYPMAAKRHSIEY
LREVAHLRPRTNLIGAVARVRHTLAQALHRFFDEQGFFWVSTPLITASDTEGAGEMFRVS
TLDLENLPRNDQGRVDFDKDFFGKESFLTVSGQLNGETYACALSKIYTFGPTFRAENSNT
SRHLAEFWMLEPEVAFADLEDNARLAEAMLKYVFKAVLEERADDMKFFAERVDKDAIARL
ERFVSTDFAQVDYTDAVAILERCGKTFENPVFWGVDLSSEHERYLAEEHFKAPVVVKNYP
KEIKAFYMRLNEDGKTVAAMDVLAPGIGEIIGGSQREERLDVLDARMAEMGLNKEDYWWY
RDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTPRNASF
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgagcgttgtgcctgtagccgacgtactccagggccgcgtagccgttgaccaagaagtc
accgtgcgcggatgggtgcgtacccgccgagattcaaaagctggcatctccttcctcgcc
gtttatgacggctcctgctttgatcctgtacaggctgtcattaataattctctgcccaat
tataatgaagaagtattacacctgacgacaggctgctccgtggtagtaacaggtaaggtt
gtcgcgtcgccgggacaggggcaaagtttcgaaatccaggctacgaaagtagaggtcgca
ggctgggtggaagatccggatacctacccgatggcggcaaaacgccatagcattgagtat
ctgcgtgaggtcgcgcatctgcgcccgcgcaccaacctgattggcgcggtagcgcgcgtt
cgccatactctggcgcaggcgctgcatcgcttcttcgatgagcagggtttcttttgggtc
tccaccccgctgattaccgcttccgataccgaaggcgctggtgaaatgttccgcgtctca
acgttggatctggaaaacctgccgcgtaacgaccagggcagagtagattttgacaaagac
ttttttggcaaagaatcattcctgaccgtctccggccagctcaacggtgaaacgtatgcc
tgtgcgctgtccaaaatctatacttttgggccgaccttccgcgcggaaaattccaacacc
agccgccacctggcggagttctggatgctggagccggaagtggcgttcgccgatctggaa
gacaacgcccgtctggcggaagccatgctgaaatatgtcttcaaggcggttctggaagag
cgtgcggatgatatgaagttctttgccgaacgcgtagataaagacgctatcgctcgtctg
gagcgttttgtctctaccgacttcgctcaggtggattacaccgatgcggtcgccattctg
gaacgctgtggtaagacatttgaaaacccggtgttctggggcgtcgacctctcttccgaa
cacgaacgttatctggcggaagagcatttcaaagcgccggtagtggtgaaaaactatccg
aaggaaattaaagcattttacatgcgccttaacgaagatggcaaaaccgtggcggccatg
gatgtgctggcgccgggaatcggcgaaatcatcggtggttcccagcgtgaagagcgtctg
gatgtgctggatgcccgtatggccgaaatggggctgaataaagaggattactggtggtat
cgcgacttgcgtcgctacggtactgtaccgcattccggctttggcctgggctttgaacgc
cttatcgcttacgtcacgggtgtgcaaaacgtgcgcgatgttattccgttcccacggacc
ccacgcaacgccagcttctga

DBGET integrated database retrieval system