KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2007
Entry
SPUL_2007         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Other DBs
NCBI-ProteinID: AET54334
Position
complement(2000771..2000887)
AA seq 38 aa
MPEKAAEELFHKNSHLEVLMSEIVVKNCAIRTEKSNPQ
NT seq 117 nt   +upstreamnt  +downstreamnt
gtgcctgaaaaagcagcagaagagctatttcataaaaatagccatttagaagtcttgatg
tctgaaattgtggtgaaaaattgtgctattagaacagaaaaatctaatccgcaataa

DBGET integrated database retrieval system