KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2008
Entry
SPUL_2008         CDS       T01740                                 

Gene name
ompF
Definition
(GenBank) outer membrane protein F precursor
  KO
K09476  outer membrane pore protein F
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel01501  beta-Lactam resistance
sel02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SPUL_2008 (ompF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SPUL_2008 (ompF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sel02000]
    SPUL_2008 (ompF)
   01504 Antimicrobial resistance genes [BR:sel01504]
    SPUL_2008 (ompF)
Transporters [BR:sel02000]
 Other transporters
  Pores ion channels [TC:1]
   SPUL_2008 (ompF)
Antimicrobial resistance genes [BR:sel01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, repression of porin OmpF [MD:M00746]
    SPUL_2008 (ompF)
SSDB
Motif
Pfam: Porin_1 Porin_4 DUF4148 DUF2490
Other DBs
NCBI-ProteinID: AET54335
Structure
PDB: 
3NSG 4KR8 4KRA 4KR4

Position
2001200..2002291
AA seq 363 aa
MMKRKILAAVIPALLAAATANAAEIYNKDGNKLDLYGKAVGRHVWTTTGDSKNADQTYAQ
IGFKGETQINTDLTGFGQWEYRTKADRAEGEQQNSNLVRLAFAGLKYAEVGSIDYGRNYG
IVYDVESYTDMAPYFSGETWGGAYTDNYMTSRAGGLLTYRNSDFFGLVDGLSFGIQYQGK
NQDNHSINSQNGDGVGYTMAYEFDGFGVTAAYSNSKRTNDQQDRDGNGDRAESWAVGAKY
DANNVYLAAVYAETRNMSIVENTVTDTVEMANKTQNLEVVAQYQFDFGLRPAISYVQSKG
KQLNGADGSADLAKYIQAGATYYFNKNMNVWVDYRFNLLDENDYSSSYVGTDDQAAVGIT
YQF
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgatgaagcgcaaaatcctggcagcggtgatccctgccctgctggctgctgcaaccgca
aacgcagcagaaatttataataaagatggtaataagctggatctgtacggtaaagccgtg
ggtcgtcacgtatggacaacgaccggcgatagcaaaaatgccgaccagacttatgcccag
attggttttaaaggggaaacgcagattaacaccgatctgaccggtttcggtcagtgggaa
taccgtactaaagcagaccgcgctgaaggcgaacagcagaactcgaatctggtccgtctg
gccttcgcgggtttgaaatacgcggaagtggggtcaatcgattatggtcgtaactacggt
atcgtttacgatgttgaatcctataccgatatggccccctacttctccggcgaaacctgg
ggcggcgcctatactgataactacatgaccagccgtgctggcggtttgttgacctaccgt
aactctgacttctttggtctggtggacggtctctctttcggtatccagtatcagggtaaa
aatcaggacaaccacagcattaactctcagaatggcgatggcgtaggttacaccatggca
tatgagttcgacggctttggcgtcaccgcagcgtacagcaacagcaagcgtactaacgat
cagcaggatcgcgatggtaatggcgatcgcgcagaatcatgggccgttggcgcgaaatat
gatgcaaacaacgtctacctggctgccgtatatgctgaaacccgcaatatgagcattgtt
gaaaatacggttaccgataccgtggaaatggcaaacaaaacgcagaacctggaagtggtc
gctcagtaccagtttgacttcggcctgcgtccggcaatctcgtatgtgcagagtaaaggt
aagcagttgaacggcgccgacggctcggccgatctggcgaaatatattcaggcgggcgcg
acttactacttcaacaaaaacatgaacgtatgggttgactaccgtttcaacctgctggac
gaaaacgactacagctccagctacgttggcaccgacgatcaggcggctgtcggtattact
taccagttctga

DBGET integrated database retrieval system