KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2009
Entry
SPUL_2009         CDS       T01740                                 

Gene name
aspC
Definition
(GenBank) aspartate aminotransferase
  KO
K00813  aspartate aminotransferase [EC:2.6.1.1]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00220  Arginine biosynthesis
sel00250  Alanine, aspartate and glutamate metabolism
sel00270  Cysteine and methionine metabolism
sel00330  Arginine and proline metabolism
sel00350  Tyrosine metabolism
sel00360  Phenylalanine metabolism
sel00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sel00401  Novobiocin biosynthesis
sel01100  Metabolic pathways
sel01110  Biosynthesis of secondary metabolites
sel01210  2-Oxocarboxylic acid metabolism
sel01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPUL_2009 (aspC)
   00270 Cysteine and methionine metabolism
    SPUL_2009 (aspC)
   00220 Arginine biosynthesis
    SPUL_2009 (aspC)
   00330 Arginine and proline metabolism
    SPUL_2009 (aspC)
   00350 Tyrosine metabolism
    SPUL_2009 (aspC)
   00360 Phenylalanine metabolism
    SPUL_2009 (aspC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPUL_2009 (aspC)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SPUL_2009 (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sel01007]
    SPUL_2009 (aspC)
Enzymes [BR:sel01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     SPUL_2009 (aspC)
Amino acid related enzymes [BR:sel01007]
 Aminotransferase (transaminase)
  Class I
   SPUL_2009 (aspC)
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-ProteinID: AET54336
Position
2002476..2003666
AA seq 396 aa
MFENITAAPADPILGLADLFRADDRPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENE
TTKNYLGIDGIPEFARCTQELLFGKGSALINDKRARTAQTPGGTGALRIAADFLAKNTPV
KRVWVSNPSWPNHKSVFNAAGLEVREYAYYDAENHTLDFEALQASLSEAQAGDVVLFHGC
CHNPTGIDPTLEQWQVLAELSVEKGWLPLFDFAYQGFARGQEEDAEGLRAFAALHKELIV
ASSYSKNFGLYNERVGACTLVAADAETVDRAFSQMKSAIRANYSNPPAHGASIVATILSN
DALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKDQVLR
LREEFGVYAVASGRVNVAGMTPDNMEPLCEAIVAVL
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgtttgagaacataaccgccgctcctgccgacccgattttgggcctggccgatctgttt
cgcgccgatgaccgtccagggaaaattaaccttggcattggcgtatataaagatgaaacc
ggcaaaacaccggtgctcaccagcgttaaaaaagccgagcagtatttactggaaaatgaa
acgacgaaaaactatctcggcattgacgggattccggaatttgctcgctgcactcaggaa
ctgctgttcggcaaaggcagcgcgctgattaacgacaagcgcgcacgcacggcgcaaacg
ccgggcggtaccggcgcgttacgcattgccgccgactttttggcaaaaaatactccggta
aaacgggtgtgggtgagcaaccccagctggccgaaccacaaaagcgtgtttaacgctgcc
ggcctggaagttcgggagtacgcttactacgatgcggaaaatcacacgctggattttgaa
gcgctacaagccagcctgagcgaagcacaggccggcgatgtggttctgttccacggttgc
tgtcataacccaaccggcattgaccctactctggaacagtggcaggttctggctgagctt
tccgttgaaaaagggtggctgccgctattcgatttcgcttaccagggctttgcccgcggc
caggaagaagatgcggaaggtctgcgcgcctttgccgcgctgcataaagagcttattgtc
gccagctcctactccaaaaacttcggcttatataatgagcgcgtcggcgcctgcaccctc
gtggctgccgatgcggaaaccgtggatcgcgcttttagccagatgaaatccgccattcgc
gctaactactccaacccgccagcgcacggcgcgtccatcgtcgcgactatcctgagtaat
gacgccctgcgcgctatctgggaacaggaactgacggacatgcgccagcgtattcagcgt
atgcgtcaactgttcgtgaataccttgcaggaaaaaggcgcgaaccgtgacttcagcttt
attatcaagcagaacgggatgttctcattcagcggtctgaccaaagatcaggtgctacgt
ctgcgtgaagagtttggcgtttatgccgtggcttctggtcgcgtgaacgtggcgggcatg
accccggataatatggagccgctgtgcgaagccattgtcgcggtactataa

DBGET integrated database retrieval system