KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2010
Entry
SPUL_2010         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00620  Pyruvate metabolism
sel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPUL_2010
Enzymes [BR:sel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.6  hydroxyacylglutathione hydrolase
     SPUL_2010
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_5 Lactamase_B_2 Lactamase_B_3
Other DBs
NCBI-ProteinID: AET54337
Structure
PDB: 
2XF4

Position
complement(2003728..2004375)
AA seq 215 aa
MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDASGVTLMQILLTHGHLD
HVGAASELAQHYGVPVIGPEKEDEFWLQGLPAQSRMFGLDECQPLTPDRWLNDGDRVSVG
NVTLQVLHCPGHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGDHTQLIDAIKRKLL
PLGDDVTFIPGHGPLSTLGYERLHNPFLQDEMPVW
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaactatcgtattattccggtcaccgcgttctcccagaactgttcattaatctggtgc
gaacaaacccggctggcggcgctggtcgatccgggcggcgacgcggaaaaaattaaacag
gaagtggacgccagcggcgtgacgttgatgcaaattttactcacgcatgggcatctcgat
catgtcggcgcggcgagtgaactggcgcagcattacggcgttcctgttatcggtccggaa
aaagaagatgagttctggctgcaaggactgccggcgcaaagccgcatgtttggtctggat
gagtgtcagccgctgacgcctgatcgctggctgaacgacggcgatcgcgtcagcgtaggg
aatgtgacgttacaggtgttacattgtccgggacacacgccgggacacgtggttttcttt
gatgaacagtcgcaactgctgatctccggcgatgtgattttcaaaggtggcgtcgggcgc
agcgattttcctcgcggcgatcacacccagttgattgacgccattaagcgtaaattattg
ccgcttggcgatgatgtgacctttattcctggccacggcccgctctctacgctcggatac
gagcgtctgcataatcccttcctgcaagatgagatgccggtctggtaa

DBGET integrated database retrieval system