KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2011
Entry
SPUL_2011         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: Peptidase_M15_2 Peptidase_M15_3
Other DBs
NCBI-ProteinID: AET54338
Position
complement(2004403..2004951)
AA seq 182 aa
MDKFDANRRKLLALGGVALGAAILPAPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRA
YIQDELAKLNHFFRDYRANKVRSIDPRLFDQLYRLQGLLGTRKPVQLISGYRSLDTNNEL
RARSSGVAKKSYHTKGQAMDFHIEGVALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPAR
HW
NT seq 549 nt   +upstreamnt  +downstreamnt
atggacaaatttgacgctaatcgccgcaagctgctggcgcttggtggtgtcgctctcggc
gccgccatcctgcccgcgccagcgtttgccacactctcgaccccacgcccgcgcattttg
acgttaaacaatctccataccggagagtcaatcaaggcggagtttttcgatggaagagcc
tacattcaggatgaattagcaaagttaaaccattttttccgtgactatcgcgcgaataaa
gtccgatcaatcgatccccgcctgtttgaccaactttaccgacttcaggggctgttaggg
acgcgtaaacctgtgcagctcatctcaggctaccgttctcttgataccaataatgaatta
cgcgcccgtagcagcggcgtagcgaaaaaaagctaccatacaaaagggcaggcgatggat
tttcatattgaaggcgtggcgctgagcaatattcgcaaagcggcgttatctatgcgcgca
ggtggtgtaggatattacccacgtagtaactttgtgcatattgataccgggccggcgcgg
cactggtaa

DBGET integrated database retrieval system