KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2013
Entry
SPUL_2013         CDS       T01740                                 

Gene name
mukB
Definition
(GenBank) cell division protein
  KO
K03632  chromosome partition protein MukB
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sel03036]
    SPUL_2013 (mukB)
Chromosome and associated proteins [BR:sel03036]
 Prokaryotic type
  Chromosome partitioning proteins
   MukBEF complex
    SPUL_2013 (mukB)
SSDB
Motif
Pfam: MukB MukB_hinge SbcCD_C AAA_29
Other DBs
NCBI-ProteinID: AET54340
Position
complement(2007406..2011872)
AA seq 1488 aa
MIERGKFRSLTLINWNGFFARTFDLDELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLHF
RNTTEAGATSGSRDKGLHGKLKAGVCYSMLDTINSRHQRVVVGVRLQQVAGRDRKVDIKP
FAIQGLPMSVQPTQLVTETLNERQARVLSLAELKDKLDEMEGVQFKQFNSITDYHSLMFD
LGIIARRLRSASDRSKFYRLIEASLYGGISSAITRSLRDYLLPENSGVRKAFQDMEAALR
ENRLTLEAIRVTQSDRDLFKHLISEATDYVAADYMRHANERRVHLDQALAFRRELYTSRK
QLAAEQYKHVDMARELGEHNGAEGSLEADYQAASDHLNLVQTALRQQEKIERYEADLEEL
QIRLEEQNEVVAEAAEMQDENEARAEAAELEVDELKSQLADYQQALDVQQTRAIQYNQAI
SALARAKELCHLPDLTPESAAEWLDTFQAKEQEATEKLLSLEQKMSVAQTAHSQFEQAYQ
LVAAINGPLARSEAWDVARELLRDGVNQRHLAEQVQPLRMRLSELEQRLREQQEAERLLA
EFCKRQGKNFDIDELEALHQELEARIASLSESVSSASEQRMALRQEQEQLQSRIQHLMQR
APVWLAAQNSLNQLSEQCGEEFTSSQEVTEYLQQLLEREREAIVERDEVGARKNAVDEEI
ERLSQPGGAEDQRLNALAERFGGVLLSEIYDDVSLEDAPYFSALYGPSRHAIVVPDLSQI
AEQLEGLTDCPEDLYLIEGDPQSFDDSVFSVDELEKAVVVKIADRQWRYSRFPSLPIFGR
AARENRIESLHAEREVLSERFATLSFDVQKTQRLHQAFSRFIGSHLSVAFEDDPEAEIRR
LNGRRVELERALATHESDNQQQRLQFEQAKEGVSALNRLLPRLNLLADETLADRVDEIQE
RLDEAQEAARFVQQYGNQLAKLEPVVSVLQSDPEQFEQLKEDYAWSQQMQRDARQQAFAL
AEVVERRAHFSYSDSAEMLSGNSDLNEKLRQRLEQAEAERTRAREALRSHAAQLSQYSQV
LASLKSSYGTKKELLNDLQRELQDIGVRADSGAEERARQRRDELHAQLSNNRSRRNQLEK
ALTFCEAEMENLTRKLRKLERDYHEMREQVVTAKAGWCAVMRMVKDNGVERRLHRRELAY
LSADELRSMSDKALGALRLAVADNEHLRDVLRLSEDPKRPERKIQFFVAVYQHLRERIRQ
DIIRTDDPVEAIEQMEIELSRLTEELTSREKKLAISSRSVANIIRKTIQREQNRIRMLNQ
GLQSVSFGQVNSVRLNVNVRETHATLLDVLSEQQEQHQDLFNSNRLTFSEALAKLYQRLN
PQIDMGQRTPQTIGEELLDYRNYLEMEVEVNRGSDGWLRAESGALSTGEAIGTGMSILVM
VVQSWEDEARRLRGKDISPCRLLFLDEAARLDARSIATLFELCERLQMQLIIAAPENISP
EKGTTYKLVRKVFQNTEHVHVVGLRGFAPQLPETLPGTQTEDTPSEAS
NT seq 4467 nt   +upstreamnt  +downstreamnt
atgattgaacgcggtaaatttcgctcgctaacgctgattaactggaacggtttttttgcc
cgtacttttgacctggatgaactggtcacgacgttatccgggggcaacggtgccgggaaa
tccacgacgatggcggcgttcgtcacggcgctgatcccggatcttacattactgcacttt
cgtaacaccacggaagccggcgccaccagcggttcgcgcgataaaggtctgcacggtaag
ctgaaggcgggcgtctgttactccatgctcgacaccattaattcccgccatcagcgggtg
gtggtcggcgtgcgtctgcagcaggtcgctgggcgcgatcgcaaagtggacatcaaaccg
ttcgctatccaggggctgccgatgtcggtacagccgacacaactggtgacggagacatta
aacgaacgtcaggcgcgcgtactgtcgcttgctgagctgaaagacaagcttgacgagatg
gaaggcgtgcagtttaagcagtttaactccatcaccgattatcattcgctgatgtttgac
ttagggattatcgcccgtcgtctgcgctccgcttccgatcgtagtaaattctatcgtttg
atagaggcctcgctgtacggcgggatctccagcgccattacccgatcgctacgcgattat
ttattgccggaaaacagcggcgtgcgcaaggcgttccaggatatggaagcggcgctgcgc
gagaaccgactcacgctggaagcgattcgtgttacccaatccgatcgcgatctgtttaag
catttgatcagcgaagccaccgattatgtggcggcggattatatgcgccacgccaatgag
cgtcgggttcaccttgatcaggcgttggcgtttcgacgcgaactgtacacatcgcgcaaa
caactggcggctgagcagtacaagcacgtcgatatggcccgtgagttgggcgaacataac
ggcgccgaaggttctcttgaggcggattaccaggcggcgagcgatcacctgaatctggtg
caaaccgcgctgcgtcagcaggaaaaaattgaacgctacgaagcggatcttgaagagctg
cagattcgactcgaagagcaaaacgaagtggtggcggaagccgccgaaatgcaggacgaa
aatgaagcgcgtgccgaagccgccgagctggaagtcgatgaactcaaaagccagcttgcg
gattaccagcaggcgctggatgtacagcaaacgcgcgcgattcagtataaccaggcgata
tcagcgcttgcccgcgctaaagaactttgtcatctgccggatctaacgccggaaagcgcc
gccgaatggctggatactttccaggcaaaagagcaggaagctacggaaaaactgctgtcg
ttggaacaaaaaatgagcgtggcgcaaaccgcgcacagccagtttgagcaggcttaccag
ctagtagcggcgatcaacggcccgctggcgcgtagcgaagcctgggacgtggcgcgcgag
ctgttacgggacggcgtgaaccagcgtcatctggcggaacaggtacagccgctgcggatg
cgcctgagcgaactggaacagcggctgcgcgagcagcaagaggcggaacgtctgctggct
gagttctgtaagcgacagggcaaaaattttgatattgacgaactggaagcgctgcatcag
gagctggaagcccgcatcgcgtccttgtctgagagcgtgtcgtcagccagcgaacagcgt
atggccttgcgtcaggaacaggaacagctgcaatcccgtatccagcatctgatgcaacgc
gctcctgtctggctggcggcgcagaatagcctgaaccagcttagcgaacagtgcggcgag
gagtttacgtccagccaggaagtgaccgaatacctgcaacagctactggagcgtgagcgc
gaagccattgtcgaacgcgacgaagtgggcgcgcgtaaaaatgcggttgatgaagagatc
gagcgtttaagccagccgggcggcgcggaagatcagcgtttgaatgcgctggcggagcgt
tttggcggggtactgctgtcggaaatctacgatgatgtcagtcttgaagatgcgccgtac
ttttccgcactgtatggcccgtcgcgccatgcgatcgtcgtaccggatttatcgcaaata
gccgaacagcttgaaggtctgaccgactgcccggaagatctgtacctgatcgaaggcgat
ccgcagtcttttgatgacagcgtattcagcgttgacgagctggaaaaggcggtggtcgtg
aaaattgccgaccgtcagtggcgttattcgcgttttccgtcgctgcctatttttggccgt
gcggcgcgcgagaaccgtattgaaagtctccatgcggaacgggaagtgctttccgagcgc
tttgccacgctctcgtttgacgtgcagaaaacccagcgtttgcaccaggcgttcagccgt
tttatcggtagccacctttctgttgcctttgaggacgatccggaagcggaaattcgccga
ctgaacgggcgtcgcgtcgagctggagcgcgcgctggcgacgcatgaaagcgacaaccag
cagcagcgccttcagtttgagcaggccaaagagggcgtttccgcgcttaaccgtttgctg
ccgcggctgaatttattggccgatgaaacgctggccgatcgggtcgatgaaattcaggaa
cggttggatgaggcgcaagaagcggcgcgatttgtgcagcaatatggcaaccagttagcc
aaactggagccggtggtttccgttctgcaaagcgatccggaacagtttgagcagttaaaa
gaagactatgcatggtcgcagcaaatgcagcgcgacgctcgccagcaggcttttgctctg
gctgaagttgtcgaacgtcgggcgcatttcagctattccgactcggcggaaatgctgagc
ggcaacagcgatctcaacgaaaagctgcgccagcggctggagcaggcggaagccgagcgt
acccgcgcccgcgaagcgctgcgcagccatgccgcgcagttaagtcagtacagccaggtc
ctggcctcgctaaaaagctcttacggcacgaaaaaagagctgcttaacgatttgcagcgc
gaattacaggatattggcgttcgcgccgacagcggggcggaagagcgtgcccgccagcgt
cgcgatgaactgcacgcccagttgagcaataaccgttcgcgtcgcaatcagcttgagaaa
gcgctcaccttctgcgaagcggagatggagaacctgacccgtaagctgcgcaagctggag
cgtgattatcatgaaatgcgcgagcaggtcgtgaccgcgaaagccggctggtgcgcagtc
atgcggatggtgaaagacaatggcgtggaacgccgtctgcaccgtcgtgagctggcttat
ctgtcggcggatgaactgcgctccatgtcggataaggcgttgggcgcgctgcgcctggcc
gtcgcggataacgaacatctgcgcgacgtattgcgtctgtcggaagatccgaaacgcccg
gaacgtaaaatccagttctttgtggccgtttaccagcatctgcgcgaacgtattcgtcag
gatattattcgtaccgacgatccggttgaagccattgaacaaatggagattgagctgagt
cgtctgacggaagagctgacatcgcgtgagaaaaagctggcgatcagttcccgcagcgtg
gcaaacattatccgcaagactatccagcgtgagcagaaccgtattcgcatgctgaaccag
gggttgcaaagcgtctcgtttggccaggtgaatagcgtgcggttaaacgtcaacgtgcgt
gaaacgcatgccaccttgctggatgtgctttcagaacagcaggagcagcatcaggatctg
tttaacagcaatcgtctgaccttctccgaagcgctggcgaaactgtaccagcgcctgaat
ccgcagatcgatatggggcaacgcacgccgcagaccatcggcgaggagctgctggactac
cgtaactatctggaaatggaagttgaagttaaccgtgggtccgacggctggctgcgtgcg
gaatccggcgcgctatcaacgggggaagctatcgggaccgggatgtcaattctggtgatg
gttgtgcaaagctgggaagacgaagcgcgcagactgcgcgggaaagatatttcgccatgt
cgcctgctgttcctcgatgaagcggcgcgtctggatgcgcgctctatcgccacgctgttt
gaactatgcgaacgtttgcagatgcagctcatcatcgccgcgccggaaaacatcagtccg
gagaagggcacgacctataaactggtgcgtaaagtgtttcagaatactgagcatgttcat
gttgtcgggctgcgtggctttgcgccgcagcttccggaaacgcttcccggtacgcaaacg
gaagatacgccttcagaagcgagttaa

DBGET integrated database retrieval system