KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2014
Entry
SPUL_2014         CDS       T01740                                 

Gene name
mukE
Definition
(GenBank) KicA protein
  KO
K03804  chromosome partition protein MukE
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sel03036]
    SPUL_2014 (mukE)
Chromosome and associated proteins [BR:sel03036]
 Prokaryotic type
  Chromosome partitioning proteins
   MukBEF complex
    SPUL_2014 (mukE)
SSDB
Motif
Pfam: MukE DUF4194 Tfb2 DCD
Other DBs
NCBI-ProteinID: AET54341
Position
complement(2011872..2012576)
AA seq 234 aa
MSLTNIEQVMPVKLAQALANPLFPALDSALRSGRHIGLDELDNHAFLMDFQEYLEEFYAR
YNVELIRAPEGFFYLRPRSTTLIPRSVLSELDMMVGKILCYLYLSPERLANEGIFTQQEL
YDELLTLADEAKLLKLVNNRSTGSDVDRQKLQEKVRSSLNRLRRLGMVWFMGHDSSKFRI
TESVFRFGADVRAGDDPREAQRRLIRDGEAMPIENHLQLNDETEESQPDSGEEE
NT seq 705 nt   +upstreamnt  +downstreamnt
atgtcattgacaaatattgaacaagtgatgccggttaagctggcgcaggcgctggcgaat
ccgttatttccggcgctggatagcgcattacgttcgggccgccacatcgggctggacgaa
ctggataatcatgcctttctgatggattttcaggaatacctggaagagttttacgcgcgt
tataacgtggaactgattcgcgcgccggaggggttcttctacctgcgtccgcgttctacc
acgcttatcccgcgctcggtgttatccgaactggatatgatggtcggtaaaattctctgc
tacctctatcttagcccggagcgtctggccaacgaagggatctttactcagcaagaattg
tacgacgagctgcttacccttgcggacgaagccaaactgctaaagctggttaataaccgc
tcgacgggatctgacgttgatcgtcagaaactgcaggaaaaggtgcgttcttctttaaac
cgcctgcgtcgtttgggcatggtatggtttatgggccacgacagcagcaaattccgcatt
accgaatcggtcttccgctttggcgcggatgtccgcgccggcgacgatcctcgcgaggcg
cagcgtcgtctcatccgcgacggggaagcgatgcccattgaaaaccatctgcaacttaat
gatgagaccgaagagagtcagccggacagtggagaggaagaataa

DBGET integrated database retrieval system