KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2015
Entry
SPUL_2015         CDS       T01740                                 

Gene name
mukF
Definition
(GenBank) killing factor KicB
  KO
K03633  chromosome partition protein MukF
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sel03036]
    SPUL_2015 (mukF)
Chromosome and associated proteins [BR:sel03036]
 Prokaryotic type
  Chromosome partitioning proteins
   MukBEF complex
    SPUL_2015 (mukF)
SSDB
Motif
Pfam: MukF_M MukF_C KicB NACHT Ist1
Other DBs
NCBI-ProteinID: AET54342
Position
complement(2012557..2013879)
AA seq 440 aa
MSEFSQTVPELVAWARKNDFSISLPVDRLSFLLAVATLNGERLDGEMSEGELVDAFRHVS
DAFEQTSETIGVRANNAINDMVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQREF
STLRLSMQLSIVAGELKRAADAAAEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRIMDE
QQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDAT
MTHDDLHVVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHVHKFIRTAIDMDKNRVFAQR
LRQSVQTYFDDPWALTYANADRLLDMRDEEMALRDDEVTGEFPPDLEYEEFNEIREQLAA
IIEEQLAIYKTRQTPLDLGLVVREYLAQYPRARHFDVARIVIDQAVRLGVAQADFTGLPA
KWQPINDYGAKVQAHVIDKY
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgagtgaattttcccagacagtccccgaactggttgcctgggccagaaaaaacgacttt
tccatctcgctgccggtagacagactttcctttctgctggcggtcgccacgttgaacggc
gaacgccttgacggtgagatgagtgaaggcgagctggtggatgcattccgccatgtgagt
gatgcgtttgagcaaaccagcgaaaccatcggcgtgcgcgcgaacaacgcgattaacgat
atggtgcgtcaacgtctgctgaaccgctttaccagcgagcaggcggaaggcaatgcgatt
taccgattaaccccgctcgggattggcatcaccgattactacattcgtcaacgcgaattc
tctacgctgcgtctttctatgcagttgtcgattgtggccggcgaattgaagcgcgcggcg
gatgcggcagcggaggggggcgatgagttccactggcatcgcaacgtttacgcgccattg
aaatattcggtggcggagattttcgacagtatcgatctcacccagcgcatcatggatgaa
cagcagcagcaggtgaaagacgatatcgcacaactgctgaataaagactggcgggcggcg
atttccagctgtgagctgctgctttccgaaacgtccggtacgctgcgcgagttgcaggat
acgctggaggcggcgggcgataagctgcaggctaacctgctgcgcattcaggatgccacg
atgacgcacgacgatctgcatgttgtcgacaggctggtgtttgacttacaaagtaaactc
gaccgcattatcagttggggtcagcagtctattgatttatggatcggctacgatcgtcac
gtgcataaatttatccgtaccgcgatcgatatggataaaaaccgtgtcttcgcccagcgg
ttgcgccagtccgtgcagacttattttgacgatccctgggcgctaacctacgcgaatgcc
gatcgtctgctggatatgcgcgatgaagagatggcgttgcgtgacgatgaagtcaccggg
gagtttccgccggatctggaatatgaagagtttaacgagatccgcgagcagttagcggcc
atcattgaagaacagctggctatctacaaaaccagacaaacgccactggatcttgggctg
gtggtgcgcgagtatctggcgcaatacccgcgcgcgcgtcatttcgacgtggcgcgtatt
gttatcgatcaagcggtacgtcttggcgtagcgcaagcagatttcaccggactgccagcc
aaatggcagccgattaatgattacggagccaaggtacaggcgcatgtcattgacaaatat
tga

DBGET integrated database retrieval system