KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2016
Entry
SPUL_2016         CDS       T01740                                 

Gene name
smtA
Definition
(GenBank) SmtA protein
  KO
K06219  S-adenosylmethionine-dependent methyltransferase
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99988 Secondary metabolism
    SPUL_2016 (smtA)
SSDB
Motif
Pfam: Methyltransf_31 Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_12 Ubie_methyltran MTS Methyltransf_24 Methyltransf_15 CMAS TPMT NodS DREV Methyltransf_32 CheR TehB Methyltransf_9 MetW adh_short Methyltransf_18 Methyltransf_20 3HCDH_N
Other DBs
NCBI-ProteinID: AET54343
Position
complement(2013872..2014675)
AA seq 267 aa
MQDRNFDDIAEKFSRNIYGTTKGQLRQAILWQDLDRVLEEIGGRKLRVLDAGCGEGQTAI
KMAERGHQVTLCDLSGEMIARARQAAEAKGVSKDMHFIQCPAQDVASHLESPVDLILFHA
VLEWVADPVGVLETLWSVLRPGGALSLMFYNANGLLMHNMVAGNFDYVQAGMPKRKKRTL
SPDYPRDPAQVYQWLEAIGWQITGKTGVRVFHDYLREKHQQRDCYETLVELETRYCRQEP
YISLGRYIHVTAIKSPALAADARITYE
NT seq 804 nt   +upstreamnt  +downstreamnt
atgcaggatcgcaattttgatgacattgctgaaaagttttcccgtaacatttacggcacg
accaaaggacaactgcggcaagccattctgtggcaagacctggatcgcgtgctggaggag
attggcgggcggaaactgcgggtgctggatgccggctgcggcgaagggcaaacggcgatt
aagatggcggaacgcggccatcaggtgacgttatgcgatctgtctggcgaaatgatcgcc
cgcgcgcggcaggcggccgaggcaaaaggtgtgagcaaagacatgcattttatacaatgc
ccggctcaggacgtcgcttcgcatttggaaagcccggttgatctgatattgtttcatgct
gtgctggagtgggtagccgatcctgtcggcgtattagaaacgctctggtcagtattgcgc
cctggcggcgcgctgtcgttgatgttctataacgctaacggtttgctgatgcacaatatg
gtggcgggtaattttgactacgtgcaggcggggatgcctaaacgcaagaagcgcacgctg
tcgcctgactacccgcgcgaccccgcgcaggtgtaccagtggctggaggcgattggttgg
cagattaccggtaaaaccggcgtgcgtgtgtttcatgattatctgcgtgaaaaacaccag
cagcgtgactgttatgagaccctggtcgaactggaaacgcgttattgccgccaggagccg
tatattagccttgggcgctacattcatgtcaccgcgattaaaagcccggcgctagccgca
gatgcaaggataacctatgagtga

DBGET integrated database retrieval system