KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2017
Entry
SPUL_2017         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: DUF218
Other DBs
NCBI-ProteinID: AET54344
Position
2014811..2015587
AA seq 258 aa
MLFTLKKVIGGMLLPLPLMLLIIGVGLALLWFSRFQKTGKVFISVGWLALLLLSLQPVSD
HLLRPIENRYPTWQGPQKVEYIVVLGGGYTWNPQWAPSSNLINNSLPRLAEGIRLWRANP
GARLIFTGGIAKTNTVSTAEVGARVAQSLGVPRSDIITLDKPKDTEEEAAAVKQAIGDAP
FLLVTSASHLPRAMIFFQHAGLNPLPAPANQLAIDSPLNPWERAIPSPVWLMHSDRAGYE
TLGRLWQWLKGISGKPGE
NT seq 777 nt   +upstreamnt  +downstreamnt
atgctttttacgctaaagaaagtgattggcggtatgttattgccgcttccgctgatgttg
ctgatcattggcgtcggcctggcgctgctctggtttagccgctttcagaagaccggaaaa
gtatttatcagcgtaggttggctggcgctattgctattaagcctgcaacccgtctctgac
catttgctgcgtccgatagaaaaccgctaccctacctggcagggtccgcaaaaggtggaa
tatattgtggttctcggcggcggctatacctggaacccgcagtgggcgccgagctctaat
ttaattaacaacagcttgccgcggctggcggaaggcattcggctgtggcgcgcgaatccg
ggagccaggctgatttttaccggcggcatagcaaaaaccaatacggtaagcacggcggaa
gtcggtgcgcgggtggcgcagtcgctgggcgtaccgcgtagcgatattattacgctggat
aagccaaaagatacggaagaagaagccgccgccgttaagcaggccatcggcgacgcccct
ttcctgttggtaacctccgcctcgcatttgccgcgtgcgatgattttctttcagcatgcc
gggctgaatccgcttcccgcgccggcgaatcagttggcgatcgattcgccgctcaatccc
tgggagcgggcaattccgtccccggtctggctgatgcacagcgatcgcgctgggtatgaa
acattagggcgactttggcaatggctgaaaggcatatcaggcaagccaggggagtaa

DBGET integrated database retrieval system