KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2018
Entry
SPUL_2018         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
SSDB
Motif
Pfam: APH Caf4
Other DBs
NCBI-ProteinID: AET54345
Position
complement(2015567..2016460)
AA seq 297 aa
MEQLRAELSHLLGEKLSRIECVNEKADSALWSLYDSQGIPMPLMARSFTTPGVAQQLAWK
TSMLARSGTVRMPVIYGVLTHEEHLGPDVLLLERLRGVPVEAPARTPERWEQLKDQIVEG
LLAWHRQDSRGCVGAVDHTQENIWPSWYRQRVEVLWTTLNQFSNTGLTMQDRRILFRTRE
CLPSLFEGFNDNCVLVHGNFCLRSMLKDARSDQLLAMVGPGLMLWAPREFELFRLMDNPL
AEGLLWHYLQRAPVAESFIWRRWLYVLWDEVAQLVNTGRFNRTNFDLAAKSLLPWLA
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaacagttgcgggccgaactcagtcatttgttgggtgaaaaacttagccgtatagag
tgcgtgaatgagaaagcggattccgcattgtggtcattatatgacagccagggcatcccg
atgccgctgatggcgcgaagttttaccactcccggcgttgcgcagcaactggcctggaaa
acctcaatgctggcgcgtagcggtacggtgaggatgccggtaatctatggcgtattgacg
catgaagagcatcttggtccggatgtgctgctgctggaacgactgcgcggtgtaccggta
gaggcgccggcgcgcactccggaacgctgggaacagctaaaagatcagattgtcgaaggg
ctgttagcctggcatcggcaggatagccgcggttgcgttggcgccgtagaccatactcag
gagaatatctggccttcctggtatcgtcagcgggtggaggtgctgtggacgacgctaaat
cagttcagcaataccggcctgacgatgcaggacagacgcattctgtttcgtaccagagaa
tgtcttccttcgttatttgaagggtttaacgacaactgcgtactggtgcatggcaacttc
tgcctgcgcagtatgcttaaagacgcccgtagcgatcagcttctggcgatggtcggcccc
gggctgatgctgtgggcgccgagagagttcgaactgtttcgcctgatggataatccattg
gcggagggattgctttggcattatctgcaacgcgcgccagtggcggagtccttcatctgg
cggcgttggctctatgtgctgtgggacgaggttgcgcaattggtcaataccggacgtttt
aaccgtaccaattttgatctggcggcgaaatcattactcccctggcttgcctga

DBGET integrated database retrieval system