KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2019
Entry
SPUL_2019         CDS       T01740                                 

Gene name
kdsB
Definition
(GenBank) 3-deoxy-manno-octulosonate cytidylyltransferase
  KO
K00979  3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC:2.7.7.38]
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Pathway
sel00540  Lipopolysaccharide biosynthesis
sel01100  Metabolic pathways
Module
sel_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:sel00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    SPUL_2019 (kdsB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:sel01005]
    SPUL_2019 (kdsB)
Enzymes [BR:sel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.38  3-deoxy-manno-octulosonate cytidylyltransferase
     SPUL_2019 (kdsB)
Lipopolysaccharide biosynthesis proteins [BR:sel01005]
 Unusual sugar
  SPUL_2019 (kdsB)
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3 DUF2064 NTP_transferase
Other DBs
NCBI-ProteinID: AET54346
Position
complement(2016671..2017417)
AA seq 248 aa
MSFVVIIPARFSSTRLPGKPLVDINGKPMIVHVLERARESGAERIIVATDHEDVARAVEA
AGGEVCMTRADHQSGTERLAEVVEKCGFSDDTVIVNVQGDEPMIPAVIIRQVAENLAQHQ
VGMATLAVPIHSAEEAFNPNAVKVVLDAEGYALYFSRATIPWDRDRFAKSLETVGDTCLR
HLGIYGYRAGFIRRYVSWQPSPLEHIEMLEQLRVLWYGEKIHVAVAKAVPGTGVDTADDL
ERVRAEMR
NT seq 747 nt   +upstreamnt  +downstreamnt
atgagtttcgtcgtcatcattccggcccgtttttcatctacccgactgccaggaaaacca
ttagtggatattaatggtaagcccatgattgttcatgtcctggagcgggcgcgcgaatct
ggcgcggaacgcattattgttgccaccgatcatgaagacgtggctcgtgcggtagaagcg
gctggcggcgaagtgtgcatgacgcgcgccgatcaccagtccggcaccgaacggttggcg
gaagtggtagagaagtgcggattcagcgacgataccgttattgtgaacgttcagggcgat
gagccgatgatcccggcggttattattcgccaggtcgcggaaaatctggcgcagcaccag
gttggcatggcgacgttggcggtgccgattcacagcgccgaagaagcgtttaacccgaat
gcggtaaaagtcgtgctggatgctgaaggctatgcgctttacttttcccgggcgacgatt
ccctgggatcgcgaccgctttgcaaaaagtctggaaacggtaggagatacttgccttcgt
cacctgggcatttatggctatcgcgcgggttttatccgccgttacgtgagctggcaaccc
agcccgctggaacatattgaaatgctggagcaactccgtgtgctgtggtacggcgaaaaa
attcatgtcgccgtcgccaaagcggtgcccggcacgggcgtagacaccgccgacgacctg
gagcgcgtgcgcgctgaaatgcgttaa

DBGET integrated database retrieval system