KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078: SPUL_2020
Entry
SPUL_2020         CDS       T01740                                 

Definition
(GenBank) hypothetical protein
  KO
K09791  uncharacterized protein
Organism
sel  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum RKS5078
Brite
KEGG Orthology (KO) [BR:sel00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SPUL_2020
SSDB
Motif
Pfam: Trm112p A2L_zn_ribbon zf-RRN7 DUF2318 TF_Zn_Ribbon
Other DBs
NCBI-ProteinID: AET54347
Position
complement(2017414..2017596)
AA seq 60 aa
MDHRLLEIIACPVCNGKLWYNQEQQELICKLDNLAFPLRDGIPVLLENEARALTSDESKS
NT seq 183 nt   +upstreamnt  +downstreamnt
atggatcatcgtctgcttgaaatcatcgcctgcccggtatgtaacggcaaactctggtat
aaccaggaacagcaagaattaatttgcaaactggataatctcgctttcccgttacgcgac
ggcattcctgtattgctggaaaatgaagctcgcgccctgacatctgatgagagtaaatca
tga

DBGET integrated database retrieval system